| UniProt ID | DUS23_HUMAN | |
|---|---|---|
| UniProt AC | Q9BVJ7 | |
| Protein Name | Dual specificity protein phosphatase 23 | |
| Gene Name | DUSP23 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 150 | |
| Subcellular Localization | Cytoplasm, cytosol. Nucleus. Mainly cytosolic. Also nuclear. | |
| Protein Description | Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).. | |
| Protein Sequence | MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Phosphorylation | RGPPHSDSCPGLTLH CCCCCCCCCCCCEEE | 25.81 | 27251275 | |
| 102 | Phosphorylation | CALGFGRTGTMLACY EECCCCCCHHHHHHH | 37.07 | 28857561 | |
| 104 | Phosphorylation | LGFGRTGTMLACYLV CCCCCCHHHHHHHHH | 14.38 | 28857561 | |
| 109 | Phosphorylation | TGTMLACYLVKERGL CHHHHHHHHHHHCCC | 14.66 | 29083192 | |
| 132 | Phosphorylation | IRRLRPGSIETYEQE HHHHCCCCCCCHHHH | 21.67 | 28857561 | |
| 136 | Phosphorylation | RPGSIETYEQEKAVF CCCCCCCHHHHHHHH | 11.65 | 27642862 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DUS23_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DUS23_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DUS23_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...