UniProt ID | DUS23_HUMAN | |
---|---|---|
UniProt AC | Q9BVJ7 | |
Protein Name | Dual specificity protein phosphatase 23 | |
Gene Name | DUSP23 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 150 | |
Subcellular Localization | Cytoplasm, cytosol. Nucleus. Mainly cytosolic. Also nuclear. | |
Protein Description | Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).. | |
Protein Sequence | MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | RGPPHSDSCPGLTLH CCCCCCCCCCCCEEE | 25.81 | 27251275 | |
102 | Phosphorylation | CALGFGRTGTMLACY EECCCCCCHHHHHHH | 37.07 | 28857561 | |
104 | Phosphorylation | LGFGRTGTMLACYLV CCCCCCHHHHHHHHH | 14.38 | 28857561 | |
109 | Phosphorylation | TGTMLACYLVKERGL CHHHHHHHHHHHCCC | 14.66 | 29083192 | |
132 | Phosphorylation | IRRLRPGSIETYEQE HHHHCCCCCCCHHHH | 21.67 | 28857561 | |
136 | Phosphorylation | RPGSIETYEQEKAVF CCCCCCCHHHHHHHH | 11.65 | 27642862 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DUS23_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DUS23_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DUS23_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...