UniProt ID | PTSS2_HUMAN | |
---|---|---|
UniProt AC | Q9BVG9 | |
Protein Name | Phosphatidylserine synthase 2 | |
Gene Name | PTDSS2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 487 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Highly enriched in the mitochondria-associated membrane (MAM).. |
|
Protein Description | Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine.. | |
Protein Sequence | MRRGERRDAGGPRPESPVPAGRASLEEPPDGPSAGQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGFVPAHFLGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLRRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKPHKKLGPQAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWRFFLRDITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | AGGPRPESPVPAGRA CCCCCCCCCCCCCCC | 33.60 | 29255136 | |
24 | Phosphorylation | PVPAGRASLEEPPDG CCCCCCCCCCCCCCC | 34.65 | 28355574 | |
33 | Phosphorylation | EEPPDGPSAGQATGP CCCCCCCCCCCCCCC | 51.03 | 23927012 | |
46 | Phosphorylation | GPGEGRRSTESEVYD CCCCCCCCCCEEEEE | 34.86 | - | |
47 | Phosphorylation | PGEGRRSTESEVYDD CCCCCCCCCEEEEEC | 41.54 | - | |
156 | Phosphorylation | DGRQFLKYVDPKLGV HHHHHHHHCCCCCCC | 16.54 | - | |
160 | 2-Hydroxyisobutyrylation | FLKYVDPKLGVPLPE HHHHCCCCCCCCCCC | 54.10 | - | |
160 | Ubiquitination | FLKYVDPKLGVPLPE HHHHCCCCCCCCCCC | 54.10 | 21890473 | |
181 | N-linked_Glycosylation | CLIYDPDNETDPFHN EEEECCCCCCCCCCC | 60.50 | 19159218 | |
205 | Phosphorylation | PAHFLGWYLKTLMIR HHHHHHHHHHHHHHH | 9.12 | - | |
271 | Ubiquitination | TLEWLSLKTYKWQGL HHHHHHCCEEEECCC | 46.57 | 21890473 | |
274 | Ubiquitination | WLSLKTYKWQGLWNI HHHCCEEEECCCCCC | 37.97 | 21890473 | |
285 | Ubiquitination | LWNIPTYKGKMKRIA CCCCCCCCCCEEEEE | 55.31 | 21890473 | |
309 | Phosphorylation | RFEWKPASSLRRWLA EEEEECHHHHHHHHH | 38.13 | 23898821 | |
310 | Phosphorylation | FEWKPASSLRRWLAV EEEECHHHHHHHHHH | 28.18 | 23898821 | |
366 | Phosphorylation | GVAMREIYDFMDDPK CHHHHHHHHHCCCCC | 9.81 | - | |
447 | Ubiquitination | YKETRWQKWQNKDDQ CHHHHHHHCCCCCCC | 43.73 | 21890473 | |
485 | Phosphorylation | AEGEGAPTPN----- CCCCCCCCCC----- | 34.62 | 17192257 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTSS2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTSS2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTSS2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STOM_HUMAN | STOM | physical | 27173435 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00144 | Phosphatidylserine |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-181, AND MASSSPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. | |
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16 AND THR-485, AND MASSSPECTROMETRY. | |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. | |
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. | |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. |