RAB28_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB28_HUMAN
• UniProt AC: P51157
• Protein Name: Ras-related protein Rab-28
• Gene Name: RAB28
• Organism: Homo sapiens (Human).
• Sequence Length: 221
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasm, cytoskeleton, cilium basal body. Expressed in the basal body and ciliary rootlet of the photoreceptors..
• Protein Sequence: MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDSEEESQ ------CCHHHHHHH	50.25	25849741
2 (in isoform 2)	Phosphorylation	-	50.25	24719451
2	Acetylation	------MSDSEEESQ ------CCHHHHHHH	50.25	21406692
4	Phosphorylation	----MSDSEEESQDR ----CCHHHHHHHHC	39.33	25849741
4 (in isoform 2)	Phosphorylation	-	39.33	24719451
8	Phosphorylation	MSDSEEESQDRQLKI CCHHHHHHHHCCEEE	40.43	21406692
23	Phosphorylation	VVLGDGASGKTSLTT EEECCCCCCCCCHHH	46.48	30622161
25	Ubiquitination	LGDGASGKTSLTTCF ECCCCCCCCCHHHHH	32.23	29967540
26	Phosphorylation	GDGASGKTSLTTCFA CCCCCCCCCHHHHHH	32.28	30622161
27	Phosphorylation	DGASGKTSLTTCFAQ CCCCCCCCHHHHHHH	27.49	30622161
29	Phosphorylation	ASGKTSLTTCFAQET CCCCCCHHHHHHHHH	22.68	30622161
39	Acetylation	FAQETFGKQYKQTIG HHHHHHHHHHHHHHC	46.38	25953088
39	Ubiquitination	FAQETFGKQYKQTIG HHHHHHHHHHHHHHC	46.38	29967540
44	Phosphorylation	FGKQYKQTIGLDFFL HHHHHHHHHCCEEEE	16.92	22210691
73	Phosphorylation	IWDIGGQTIGGKMLD EEEECCCEECCEECH	25.51	22210691
115	Phosphorylation	YTVVKKVSEESETQP HHHHHHHCCCCCCCC	44.52	30622161
118	Phosphorylation	VKKVSEESETQPLVA HHHHCCCCCCCCEEE	41.72	30622161
120	Phosphorylation	KVSEESETQPLVALV HHCCCCCCCCEEEHH	44.78	30622161
130	Ubiquitination	LVALVGNKIDLEHMR EEEHHCCCCCHHHHH	31.50	29967540
143	Ubiquitination	MRTIKPEKHLRFCQE HHCCCHHHHHHHHHH	57.37	29967540
184	Ubiquitination	ILGIKLNKAEIEQSQ HHCCCCCHHHHHHHH	58.81	29967540
201	Phosphorylation	VKADIVNYNQEPMSR EECCEECCCCCCCCC	13.82	28060719
207	Phosphorylation	NYNQEPMSRTVNPPR CCCCCCCCCCCCCCC	35.20	28060719
209	Phosphorylation	NQEPMSRTVNPPRSS CCCCCCCCCCCCCHH	19.82	-
218	Methylation	NPPRSSMCAVQ---- CCCCHHCCCCC----	3.47	-
218	Farnesylation	NPPRSSMCAVQ---- CCCCHHCCCCC----	3.47	17411337
218	Farnesylation	NPPRSSMCAVQ---- CCCCHHCCCCC----	3.47	17411337

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB28_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB28_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB28_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
PDE6D_HUMAN	PDE6D	physical	27173435
NCOA3_HUMAN	NCOA3	physical	27173435
CATL2_HUMAN	CTSV	physical	27173435
C144A_HUMAN	CCDC144A	physical	27173435
HMMR_HUMAN	HMMR	physical	27173435
KIF7_HUMAN	KIF7	physical	27173435
HSF1_HUMAN	HSF1	physical	27173435
MNS1_HUMAN	MNS1	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 615374: Cone-rod dystrophy 18 (CORD18)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Prenylation

"Towards complete sets of farnesylated and geranylgeranylatedproteins.";
Maurer-Stroh S., Koranda M., Benetka W., Schneider G., Sirota F.L.,Eisenhaber F.;
PLoS Comput. Biol. 3:634-648(2007).
Cited for: ISOPRENYLATION AT CYS-218.
PubMed: 17411337