UniProt ID | ASB13_HUMAN | |
---|---|---|
UniProt AC | Q8WXK3 | |
Protein Name | Ankyrin repeat and SOCS box protein 13 | |
Gene Name | ASB13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 278 | |
Subcellular Localization | ||
Protein Description | May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.. | |
Protein Sequence | MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
191 | Ubiquitination | TALHHAAKVKNVDLI HHHHHHHHCCCCCHH | 55.30 | 29967540 | |
216 | Ubiquitination | YARDNRGKKPSDYTW EEECCCCCCCCCCCC | 59.27 | - | |
261 | Ubiquitination | TGVRGLEKIAKLNIP CCCCCHHHHHHCCCC | 53.67 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASB13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASB13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASB13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MARK3_HUMAN | MARK3 | physical | 16169070 | |
RPC1_HUMAN | POLR3A | physical | 24337577 | |
ELOB_HUMAN | TCEB2 | physical | 24337577 | |
SSBP_HUMAN | SSBP1 | physical | 24337577 | |
ELOC_HUMAN | TCEB1 | physical | 24337577 | |
RBX2_HUMAN | RNF7 | physical | 24337577 | |
TCPQ_HUMAN | CCT8 | physical | 24337577 | |
CUL5_HUMAN | CUL5 | physical | 24337577 | |
ZMIZ2_HUMAN | ZMIZ2 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...