| UniProt ID | HDDC2_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z4H3 | |
| Protein Name | HD domain-containing protein 2 | |
| Gene Name | HDDC2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 204 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASVSSATF ------CCCCCCCCC | 20.74 | 19413330 | |
| 3 | Phosphorylation | -----MASVSSATFS -----CCCCCCCCCC | 22.64 | 29255136 | |
| 5 | Phosphorylation | ---MASVSSATFSGH ---CCCCCCCCCCCH | 16.26 | 29255136 | |
| 6 | Phosphorylation | --MASVSSATFSGHG --CCCCCCCCCCCHH | 29.22 | 29255136 | |
| 10 | Phosphorylation | SVSSATFSGHGARSL CCCCCCCCCHHHHHH | 26.06 | - | |
| 45 | Phosphorylation | RNVQRPESVSDHMYR CCCCCCCCCCHHHHH | 29.60 | 30108239 | |
| 47 | Phosphorylation | VQRPESVSDHMYRMA CCCCCCCCHHHHHHH | 30.95 | 30108239 | |
| 107 | Ubiquitination | RREEEAMKQITQLLP HHHHHHHHHHHHHCC | 45.67 | - | |
| 122 | Phosphorylation | EDLRKELYELWEEYE HHHHHHHHHHHHHHH | 15.29 | 27642862 | |
| 128 | Phosphorylation | LYELWEEYETQSSAE HHHHHHHHHCCCHHH | 16.86 | 26074081 | |
| 130 | Phosphorylation | ELWEEYETQSSAEAK HHHHHHHCCCHHHHH | 32.61 | 26074081 | |
| 132 | Phosphorylation | WEEYETQSSAEAKFV HHHHHCCCHHHHHHH | 38.65 | 26074081 | |
| 133 | Phosphorylation | EEYETQSSAEAKFVK HHHHCCCHHHHHHHH | 21.95 | 26074081 | |
| 152 | Phosphorylation | CEMILQASEYEDLEH HCHHHHHHCCCCCCC | 27.96 | 28796482 | |
| 154 | Phosphorylation | MILQASEYEDLEHKP HHHHHHCCCCCCCCC | 16.55 | 28796482 | |
| 168 | Phosphorylation | PGRLQDFYDSTAGKF CCCHHHHHHCCCCCC | 19.78 | 27642862 | |
| 174 | Ubiquitination | FYDSTAGKFNHPEIV HHHCCCCCCCCHHHH | 40.29 | - | |
| 185 | Phosphorylation | PEIVQLVSELEAERS HHHHHHHHHHHHHHH | 45.09 | - | |
| 200 | Phosphorylation | TNIAAAASEPHS--- CCHHHHHCCCCC--- | 47.11 | 29978859 | |
| 204 | Phosphorylation | AAASEPHS------- HHHCCCCC------- | 53.27 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HDDC2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HDDC2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HDDC2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HDDC2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
