UniProt ID | F177A_HUMAN | |
---|---|---|
UniProt AC | Q8N128 | |
Protein Name | Protein FAM177A1 | |
Gene Name | FAM177A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDQEPVGG -------CCCCCCCC | 12.38 | 22814378 | |
9 (in isoform 2) | Phosphorylation | - | 3.59 | 25627689 | |
13 (in isoform 2) | Phosphorylation | - | 46.31 | 25627689 | |
14 (in isoform 2) | Phosphorylation | - | 10.08 | 25627689 | |
16 (in isoform 2) | Phosphorylation | - | 11.71 | 25627689 | |
17 (in isoform 2) | Phosphorylation | - | 11.25 | 25627689 | |
18 | Phosphorylation | RGEAVAASGAAAAAA HHHHHHHHHHHHHHH | 21.16 | - | |
29 | Phosphorylation | AAAAFGESAGQMSNE HHHHHHHCHHCCCCC | 37.77 | 28122231 | |
34 | Phosphorylation | GESAGQMSNERGFEN HHCHHCCCCCCCCCC | 27.87 | 28122231 | |
49 | Ubiquitination | VELGVIGKKKKVPRR EEEEEECCCCCCCCE | 50.74 | 32015554 | |
62 | Phosphorylation | RRVIHFVSGETMEEY CEEEEEECCCCHHHC | 29.93 | 23401153 | |
65 | Phosphorylation | IHFVSGETMEEYSTD EEEECCCCHHHCCCC | 33.15 | 29255136 | |
69 | Phosphorylation | SGETMEEYSTDEDEV CCCCHHHCCCCHHHC | 11.99 | 23401153 | |
70 | Phosphorylation | GETMEEYSTDEDEVD CCCHHHCCCCHHHCC | 32.44 | 29255136 | |
71 | Phosphorylation | ETMEEYSTDEDEVDG CCHHHCCCCHHHCCC | 42.37 | 29255136 | |
72 | Ubiquitination | TMEEYSTDEDEVDGL CHHHCCCCHHHCCCC | 56.24 | 32015554 | |
81 | Ubiquitination | DEVDGLEKKDVLPTV HHCCCCCCCCCCCCC | 60.35 | 25015289 | |
82 | Ubiquitination | EVDGLEKKDVLPTVD HCCCCCCCCCCCCCC | 43.63 | 25015289 | |
93 (in isoform 2) | Phosphorylation | - | 5.53 | 24719451 | |
94 (in isoform 2) | Phosphorylation | - | 29.90 | 24719451 | |
94 | Phosphorylation | TVDPTKLTWGPYLWF CCCCCCCCCHHHHHH | 29.90 | 20166139 | |
98 | Phosphorylation | TKLTWGPYLWFYMLR CCCCCHHHHHHHHHH | 16.78 | - | |
102 | Phosphorylation | WGPYLWFYMLRAATS CHHHHHHHHHHHHHC | 5.44 | - | |
104 | Ubiquitination | PYLWFYMLRAATSTL HHHHHHHHHHHHCHH | 1.99 | 25015289 | |
105 | Ubiquitination | YLWFYMLRAATSTLS HHHHHHHHHHHCHHH | 12.97 | 25015289 | |
129 | Phosphorylation | ASVLGISTPKYQYAI HHHHCCCCCHHHHHH | 23.14 | 28674419 | |
131 (in isoform 1) | Ubiquitination | - | 45.11 | 21890473 | |
131 | Ubiquitination | VLGISTPKYQYAIDE HHCCCCCHHHHHHHH | 45.11 | 23000965 | |
134 | Phosphorylation | ISTPKYQYAIDEYYR CCCCHHHHHHHHHHH | 11.48 | - | |
139 | Phosphorylation | YQYAIDEYYRMKKEE HHHHHHHHHHHHHHH | 7.82 | 28796482 | |
140 | Phosphorylation | QYAIDEYYRMKKEEE HHHHHHHHHHHHHHH | 11.37 | 28796482 | |
154 | Ubiquitination | EEEEEENRMSEEAEK HHHHHHHHCCHHHHH | 33.03 | 23000965 | |
154 (in isoform 2) | Ubiquitination | - | 33.03 | 21890473 | |
155 (in isoform 2) | Phosphorylation | - | 9.97 | 27642862 | |
156 | Phosphorylation | EEEENRMSEEAEKQY HHHHHHCCHHHHHHH | 29.10 | 28060719 | |
157 (in isoform 2) | Phosphorylation | - | 52.46 | 27642862 | |
162 (in isoform 2) | Phosphorylation | - | 32.54 | 27642862 | |
163 (in isoform 2) | Phosphorylation | - | 24.12 | 27642862 | |
163 | Phosphorylation | SEEAEKQYQQNKLQT CHHHHHHHHHCCCCC | 24.12 | 20736484 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F177A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F177A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F177A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND THR-71, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND THR-71, AND MASSSPECTROMETRY. | |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND THR-71, AND MASSSPECTROMETRY. |