KCD21_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KCD21_HUMAN
• UniProt AC: Q4G0X4
• Protein Name: BTB/POZ domain-containing protein KCTD21
• Gene Name: KCTD21
• Organism: Homo sapiens (Human).
• Sequence Length: 260
• Protein Description: Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB). [PubMed: 21472142]
• Protein Sequence: MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	NVGGKLYTTSLATLT EECCEEEECCHHHHH	21.98	25332170
22	Phosphorylation	TTSLATLTSFPDSML ECCHHHHHCCCHHHH	24.78	25332170
23	Phosphorylation	TSLATLTSFPDSMLG CCHHHHHCCCHHHHH	37.58	-
43	Phosphorylation	KMPTKRDSQGNCFID CCCCCCCCCCCEEEC	43.98	23312004
137	Phosphorylation	APQIYSLSSSSMEVF CCCEEEECCCCCHHH	23.41	25072903
138	Phosphorylation	PQIYSLSSSSMEVFN CCEEEECCCCCHHHC	31.55	25072903
139	Phosphorylation	QIYSLSSSSMEVFNA CEEEECCCCCHHHCC	30.26	25072903
140	Phosphorylation	IYSLSSSSMEVFNAN EEEECCCCCHHHCCC	22.40	25072903
161	Phosphorylation	LFLKLLGSKLFYCSN HHHHHHCCCEEEECC	26.59	29496963
172	Phosphorylation	YCSNGNLSSITSHLQ EECCCCHHHHHHHCC	24.56	-
259	Phosphorylation	KIIRLIRYR------ EEEHHHHCC------	17.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KCD21_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KCD21_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KCD21_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of KCD21_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.