UniProt ID | GNA14_HUMAN | |
---|---|---|
UniProt AC | O95837 | |
Protein Name | Guanine nucleotide-binding protein subunit alpha-14 | |
Gene Name | GNA14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 355 | |
Subcellular Localization | ||
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.. | |
Protein Sequence | MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | S-palmitoylation | ----MAGCCCLSAEE ----CCCCEECCHHH | 0.78 | 17620339 | |
5 | S-palmitoylation | ---MAGCCCLSAEEK ---CCCCEECCHHHH | 2.27 | 17620339 | |
6 | S-palmitoylation | --MAGCCCLSAEEKE --CCCCEECCHHHHH | 3.80 | 17620339 | |
8 | Phosphorylation | MAGCCCLSAEEKESQ CCCCEECCHHHHHHH | 21.51 | 30177828 | |
36 | Ubiquitination | KKDARRELKLLLLGT HHHHHHHHHHHHHHC | 4.49 | 22817900 | |
37 | Ubiquitination | KDARRELKLLLLGTG HHHHHHHHHHHHHCC | 32.13 | 30230243 | |
46 | Phosphorylation | LLLGTGESGKSTFIK HHHHCCCCCCHHHHE | 53.52 | - | |
48 | Ubiquitination | LGTGESGKSTFIKQM HHCCCCCCHHHHEEE | 56.45 | 30230243 | |
49 | Phosphorylation | GTGESGKSTFIKQMR HCCCCCCHHHHEEEE | 31.88 | 17531806 | |
53 | Ubiquitination | SGKSTFIKQMRIIHG CCCHHHHEEEEEECC | 33.57 | 30230243 | |
76 | Phosphorylation | KGFTKLVYQNIFTAM CCCHHHHHHHHHHHH | 13.28 | 22817900 | |
81 | Phosphorylation | LVYQNIFTAMQAMIR HHHHHHHHHHHHHHH | 19.88 | 23612710 | |
92 | Phosphorylation | AMIRAMDTLRIQYVC HHHHHHHHHHHHHHH | 12.59 | 27259358 | |
100 | Ubiquitination | LRIQYVCEQNKENAQ HHHHHHHHHCHHHCE | 47.33 | 22817900 | |
147 | Phosphorylation | CYDRRREYQLSDSAK HHHHHHHHCCCCCCC | 16.97 | - | |
150 | Phosphorylation | RRREYQLSDSAKYYL HHHHHCCCCCCCEEE | 17.62 | 22817900 | |
154 | Ubiquitination | YQLSDSAKYYLTDID HCCCCCCCEEECCHH | 38.08 | 22817900 | |
155 | Phosphorylation | QLSDSAKYYLTDIDR CCCCCCCEEECCHHH | 11.92 | 30576142 | |
156 | Phosphorylation | LSDSAKYYLTDIDRI CCCCCCEEECCHHHC | 11.47 | 30576142 | |
158 | Phosphorylation | DSAKYYLTDIDRIAT CCCCEEECCHHHCCC | 18.13 | 30576142 | |
167 | Phosphorylation | IDRIATPSFVPTQQD HHHCCCCCCCCCCCC | 34.22 | - | |
171 | Phosphorylation | ATPSFVPTQQDVLRV CCCCCCCCCCCEEEE | 33.29 | - | |
179 | ADP-ribosylation | QQDVLRVRVPTTGII CCCEEEEECCCCCEE | 23.43 | - | |
179 | ADP-ribosylation | QQDVLRVRVPTTGII CCCEEEEECCCCCEE | 23.43 | - | |
183 | Phosphorylation | LRVRVPTTGIIEYPF EEEECCCCCEEECCC | 21.95 | - | |
223 | Ubiquitination | FESVTSIIFLVALSE HHHHHHHHHHHHHHH | 1.88 | 22817900 | |
281 | Phosphorylation | LLEEKIMYSHLISYF HHHHHHHHHHHHHHC | 9.08 | 25072903 | |
282 | Phosphorylation | LEEKIMYSHLISYFP HHHHHHHHHHHHHCC | 8.40 | 25072903 | |
286 | Phosphorylation | IMYSHLISYFPEYTG HHHHHHHHHCCCCCC | 27.38 | 25072903 | |
287 | Phosphorylation | MYSHLISYFPEYTGP HHHHHHHHCCCCCCC | 19.03 | 25072903 | |
287 | Ubiquitination | MYSHLISYFPEYTGP HHHHHHHHCCCCCCC | 19.03 | 22817900 | |
291 | Phosphorylation | LISYFPEYTGPKQDV HHHHCCCCCCCHHHH | 19.75 | 25072903 | |
292 | Phosphorylation | ISYFPEYTGPKQDVR HHHCCCCCCCHHHHH | 45.40 | 25072903 | |
341 | Ubiquitination | RFVFAAVKDTILQLN EEEHHHHHHHHHHHH | 44.41 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNA14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNA14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNA14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JMJD6_HUMAN | JMJD6 | physical | 23455924 | |
DNAL4_HUMAN | DNAL4 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...