UniProt ID | UBTD2_HUMAN | |
---|---|---|
UniProt AC | Q8WUN7 | |
Protein Name | Ubiquitin domain-containing protein 2 | |
Gene Name | UBTD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 234 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | SGSLNENSEGTGVAL CCCCCCCCCCCCEEC | 31.09 | 24275569 | |
40 | Ubiquitination | KKEKPKWKSDYPMTD CCCCCCCCCCCCCCC | 39.31 | 21890473 | |
43 | Phosphorylation | KPKWKSDYPMTDGQL CCCCCCCCCCCCCCH | 11.29 | - | |
46 | Phosphorylation | WKSDYPMTDGQLRSK CCCCCCCCCCCHHCC | 32.26 | - | |
53 | Ubiquitination | TDGQLRSKRDEFWDT CCCCHHCCCHHHHHC | 58.39 | 21890473 | |
68 | Ubiquitination | APAFEGRKEIWDALK CCCCCCHHHHHHHHH | 65.49 | 21890473 | |
165 | Ubiquitination | LSTGKDLKLVVRSTD ECCCCCCEEEEECCC | 49.74 | - | |
211 | Ubiquitination | KMKFEELKIPKDYVV CCCHHHCCCCCCEEE | 61.31 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBTD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBTD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBTD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC_HUMAN | UBC | physical | 20440844 | |
UBA1_HUMAN | UBA1 | physical | 25207809 | |
UBP5_HUMAN | USP5 | physical | 25207809 | |
UBC_HUMAN | UBC | physical | 25207809 | |
GALT_HUMAN | GALT | physical | 26186194 | |
CYTN_HUMAN | CST1 | physical | 26186194 | |
CYTS_HUMAN | CST4 | physical | 26186194 | |
SMR3B_HUMAN | SMR3B | physical | 26186194 | |
GALT_HUMAN | GALT | physical | 28514442 | |
SMR3B_HUMAN | SMR3B | physical | 28514442 | |
CYTN_HUMAN | CST1 | physical | 28514442 | |
CYTS_HUMAN | CST4 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...