| UniProt ID | UBTD2_HUMAN | |
|---|---|---|
| UniProt AC | Q8WUN7 | |
| Protein Name | Ubiquitin domain-containing protein 2 | |
| Gene Name | UBTD2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 234 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | ||
| Protein Sequence | MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Phosphorylation | SGSLNENSEGTGVAL CCCCCCCCCCCCEEC | 31.09 | 24275569 | |
| 40 | Ubiquitination | KKEKPKWKSDYPMTD CCCCCCCCCCCCCCC | 39.31 | 21890473 | |
| 43 | Phosphorylation | KPKWKSDYPMTDGQL CCCCCCCCCCCCCCH | 11.29 | - | |
| 46 | Phosphorylation | WKSDYPMTDGQLRSK CCCCCCCCCCCHHCC | 32.26 | - | |
| 53 | Ubiquitination | TDGQLRSKRDEFWDT CCCCHHCCCHHHHHC | 58.39 | 21890473 | |
| 68 | Ubiquitination | APAFEGRKEIWDALK CCCCCCHHHHHHHHH | 65.49 | 21890473 | |
| 165 | Ubiquitination | LSTGKDLKLVVRSTD ECCCCCCEEEEECCC | 49.74 | - | |
| 211 | Ubiquitination | KMKFEELKIPKDYVV CCCHHHCCCCCCEEE | 61.31 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBTD2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBTD2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBTD2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC_HUMAN | UBC | physical | 20440844 | |
| UBA1_HUMAN | UBA1 | physical | 25207809 | |
| UBP5_HUMAN | USP5 | physical | 25207809 | |
| UBC_HUMAN | UBC | physical | 25207809 | |
| GALT_HUMAN | GALT | physical | 26186194 | |
| CYTN_HUMAN | CST1 | physical | 26186194 | |
| CYTS_HUMAN | CST4 | physical | 26186194 | |
| SMR3B_HUMAN | SMR3B | physical | 26186194 | |
| GALT_HUMAN | GALT | physical | 28514442 | |
| SMR3B_HUMAN | SMR3B | physical | 28514442 | |
| CYTN_HUMAN | CST1 | physical | 28514442 | |
| CYTS_HUMAN | CST4 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...