SMR3B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMR3B_HUMAN
• UniProt AC: P02814
• Protein Name: Submaxillary gland androgen-regulated protein 3B
• Gene Name: SMR3B
• Organism: Homo sapiens (Human).
• Sequence Length: 79
• Subcellular Localization: Secreted.
• Protein Sequence: MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Pyrrolidone_carboxylic_acid	CFTPGESQRGPRGPY HCCCCCCCCCCCCCC	50.47	-
23	Pyrrolidone_carboxylic_acid	CFTPGESQRGPRGPY HCCCCCCCCCCCCCC	50.47	479131
23	Pyrrolidone_carboxylic_acid	CFTPGESQRGPRGPY HCCCCCCCCCCCCCC	50.47	479131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMR3B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMR3B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMR3B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBQL1_HUMAN	UBQLN1	physical	25416956
CHLE_HUMAN	BCHE	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Pyrrolidone carboxylic acid

"Isolation and amino acid sequences of proline-rich peptides of humanwhole saliva.";
Isemura S., Saitoh E., Sanada K.;
J. Biochem. 86:79-86(1979).
Cited for: PROTEIN SEQUENCE OF 23-79.
PubMed: 479131