UniProt ID | 14332_ARATH | |
---|---|---|
UniProt AC | Q01525 | |
Protein Name | 14-3-3-like protein GF14 omega | |
Gene Name | GRF2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 259 | |
Subcellular Localization | Nucleus . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated. | |
Protein Description | Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.. | |
Protein Sequence | MASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAPKPTEEQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | VEFMEKVSAAVDGDE HHHHHHHHHHCCCCC | 22.90 | 29797451 | |
49 | Phosphorylation | VEERNLLSVAYKNVI HHHHHHHHHHHHHHH | 14.10 | 25561503 | |
67 | Phosphorylation | RASWRIISSIEQKEE HHHHHHHHHHHHHHH | 23.92 | - | |
97 | Phosphorylation | SKIETELSGICDGIL HHHHHHHHHHHHHHH | 21.63 | 30291188 | |
109 | Phosphorylation | GILKLLDSRLIPAAA HHHHHHHHCCCCCCC | 29.02 | - | |
190 | Phosphorylation | FYYEILNSPDRACNL HHHHHHCCHHHHHHH | 25.40 | - | |
211 | Phosphorylation | EAIAELDTLGEESYK HHHHHHHCCCCHHHC | 49.65 | 25368622 | |
216 | Phosphorylation | LDTLGEESYKDSTLI HHCCCCHHHCCHHHH | 32.93 | 25368622 | |
232 | Phosphorylation | QLLRDNLTLWTSDMQ HHHHCCCEEECCCCC | 26.89 | 30407730 | |
235 | Phosphorylation | RDNLTLWTSDMQDDA HCCCEEECCCCCCCH | 20.26 | 30407730 | |
236 | Phosphorylation | DNLTLWTSDMQDDAA CCCEEECCCCCCCHH | 21.36 | 19880383 | |
255 | Phosphorylation | EAAAPKPTEEQQ--- HHHCCCCCHHCC--- | 59.28 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 14332_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 14332_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 14332_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...