UniProt ID | ADT2_ARATH | |
---|---|---|
UniProt AC | P40941 | |
Protein Name | ADP,ATP carrier protein 2, mitochondrial | |
Gene Name | AAC2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 385 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.. | |
Protein Sequence | MVEQTQHPTILQKVSGQLLSSSVSQDIRGYASASKRPATYQKHAAYGNYSNAAFQYPLVAASQIATTTSPVFVQAPGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
109 | Acetylation | AAPIERVKLLIQNQD CCCHHHHHHHHHCHH | 43.74 | 24727099 | |
120 | Acetylation | QNQDEMLKAGRLTEP HCHHHHHHHCCCCCC | 47.70 | 24727099 | |
195 | Phosphorylation | WFAGNLASGGAAGAS HHCCCCCCCCCCCCH | 40.71 | 19880383 | |
202 | Phosphorylation | SGGAAGASSLLFVYS CCCCCCCHHHHHEEE | 22.17 | 19880383 | |
203 | Phosphorylation | GGAAGASSLLFVYSL CCCCCCHHHHHEEEH | 28.67 | 19880383 | |
209 | Phosphorylation | SSLLFVYSLDYARTR HHHHHEEEHHHHHHH | 14.95 | 19880383 | |
212 | Phosphorylation | LFVYSLDYARTRLAN HHEEEHHHHHHHHHC | 11.86 | 19880383 | |
215 | Phosphorylation | YSLDYARTRLANDSK EEHHHHHHHHHCCCC | 23.12 | 19880383 | |
340 | Acetylation | DAFSQIVKKEGAKSL HHHHHHHHHHCHHHH | 46.89 | 24727099 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADT2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADT2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADT2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ADT2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...