dbPTM

ADT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ADT2_ARATH
UniProt AC	P40941
Protein Name	ADP,ATP carrier protein 2, mitochondrial
Gene Name	AAC2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	385
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane..
Protein Sequence	MVEQTQHPTILQKVSGQLLSSSVSQDIRGYASASKRPATYQKHAAYGNYSNAAFQYPLVAASQIATTTSPVFVQAPGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	Acetylation	AAPIERVKLLIQNQD CCCHHHHHHHHHCHH	43.74	24727099
120	Acetylation	QNQDEMLKAGRLTEP HCHHHHHHHCCCCCC	47.70	24727099
195	Phosphorylation	WFAGNLASGGAAGAS HHCCCCCCCCCCCCH	40.71	19880383
202	Phosphorylation	SGGAAGASSLLFVYS CCCCCCCHHHHHEEE	22.17	19880383
203	Phosphorylation	GGAAGASSLLFVYSL CCCCCCHHHHHEEEH	28.67	19880383
209	Phosphorylation	SSLLFVYSLDYARTR HHHHHEEEHHHHHHH	14.95	19880383
212	Phosphorylation	LFVYSLDYARTRLAN HHEEEHHHHHHHHHC	11.86	19880383
215	Phosphorylation	YSLDYARTRLANDSK EEHHHHHHHHHCCCC	23.12	19880383
340	Acetylation	DAFSQIVKKEGAKSL HHHHHHHHHHCHHHH	46.89	24727099

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ADT2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ADT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ADT2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ADT2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ADT2_ARATH

Related Literatures of Post-Translational Modification