UniProt ID | ACT7_ARATH | |
---|---|---|
UniProt AC | P53492 | |
Protein Name | Actin-7 | |
Gene Name | ACT7 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 377 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the vegetative actins which is involved in the regulation of hormone-induced plant cell proliferation and callus formation.. | |
Protein Sequence | MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKSEYDESGPSIVHRKCF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADGEDIQP ------CCCCCCCCC | 33.25 | - | |
62 | Phosphorylation | YVGDEAQSKRGILTL CCCCHHHCCCCEEEE | 31.22 | 30407730 | |
143 | Phosphorylation | VAIQAVLSLYASGRT HHHHHHHHHHHCCCC | 16.85 | 29797451 | |
192 | Sulfoxidation | RDLTDSLMKILTERG CCHHHHHHHHHHHCC | 2.69 | 23289948 | |
325 | Phosphorylation | EITALAPSSMKIKVV HHHHCCCCCCEEEEE | 37.14 | 25561503 | |
326 | Phosphorylation | ITALAPSSMKIKVVA HHHCCCCCCEEEEEC | 24.04 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACT7_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACT7_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACT7_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACT7_ARATH | ACT7 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...