ACT7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACT7_ARATH
• UniProt AC: P53492
• Protein Name: Actin-7
• Gene Name: ACT7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 377
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the vegetative actins which is involved in the regulation of hormone-induced plant cell proliferation and callus formation..
• Protein Sequence: MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKSEYDESGPSIVHRKCF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADGEDIQP ------CCCCCCCCC	33.25	-
62	Phosphorylation	YVGDEAQSKRGILTL CCCCHHHCCCCEEEE	31.22	30407730
143	Phosphorylation	VAIQAVLSLYASGRT HHHHHHHHHHHCCCC	16.85	29797451
192	Sulfoxidation	RDLTDSLMKILTERG CCHHHHHHHHHHHCC	2.69	23289948
325	Phosphorylation	EITALAPSSMKIKVV HHHHCCCCCCEEEEE	37.14	25561503
326	Phosphorylation	ITALAPSSMKIKVVA HHHCCCCCCEEEEEC	24.04	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACT7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACT7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACT7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACT7_ARATH	ACT7	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.