UniProt ID | SPZ5_ARATH | |
---|---|---|
UniProt AC | O04582 | |
Protein Name | Probable non-inhibitory serpin-Z5 | |
Gene Name | At1g62170 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 433 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEPKEKKQKLDTSEVASPSLSKTHLKKKKTKKQKIRKSQEITSPSLSKNTDLVIASPSLSNIDVGEAMKKQNDVAIFLTGIVISSVAKNSNFVFSPASINAALTMVAASSGGEQGEELRSFILSFLKSSSTDELNAIFREIASVVLVDGSKKGGPKIAVVNGMWMDQSLSVNPLSKDLFKNFFSAAFAQVDFRSKAEEVRTEVNAWASSHTNGLIKDLLPRGSVTSLTDRVYGSALYFKGTWEEKYSKSMTKCKPFYLLNGTSVSVPFMSSFEKQYIAAYDGFKVLRLPYRQGRDNTNRNFAMYIYLPDKKGELDDLLERMTSTPGFLDSHNPERRVKVGKFRIPKFKIEFGFEASSAFSDFELDVSFYQKTLIEIDEKGTEAVTFTAFRSAYLGCALVKPIDFVADHPFLFLIREEQTGTVLFAGQIFDPSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
124 | Phosphorylation | ELRSFILSFLKSSST HHHHHHHHHHHCCCH | 24.58 | 24894044 | |
263 | Phosphorylation | FYLLNGTSVSVPFMS EEEECCCEEECCCCH | 17.50 | 28011693 | |
265 | Phosphorylation | LLNGTSVSVPFMSSF EECCCEEECCCCHHH | 24.68 | 28011693 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPZ5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPZ5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPZ5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPZ5_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...