SPZ5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPZ5_ARATH
• UniProt AC: O04582
• Protein Name: Probable non-inhibitory serpin-Z5
• Gene Name: At1g62170
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 433
• Protein Sequence: MEPKEKKQKLDTSEVASPSLSKTHLKKKKTKKQKIRKSQEITSPSLSKNTDLVIASPSLSNIDVGEAMKKQNDVAIFLTGIVISSVAKNSNFVFSPASINAALTMVAASSGGEQGEELRSFILSFLKSSSTDELNAIFREIASVVLVDGSKKGGPKIAVVNGMWMDQSLSVNPLSKDLFKNFFSAAFAQVDFRSKAEEVRTEVNAWASSHTNGLIKDLLPRGSVTSLTDRVYGSALYFKGTWEEKYSKSMTKCKPFYLLNGTSVSVPFMSSFEKQYIAAYDGFKVLRLPYRQGRDNTNRNFAMYIYLPDKKGELDDLLERMTSTPGFLDSHNPERRVKVGKFRIPKFKIEFGFEASSAFSDFELDVSFYQKTLIEIDEKGTEAVTFTAFRSAYLGCALVKPIDFVADHPFLFLIREEQTGTVLFAGQIFDPSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	ELRSFILSFLKSSST HHHHHHHHHHHCCCH	24.58	24894044
263	Phosphorylation	FYLLNGTSVSVPFMS EEEECCCEEECCCCH	17.50	28011693
265	Phosphorylation	LLNGTSVSVPFMSSF EECCCEEECCCCHHH	24.68	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPZ5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPZ5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPZ5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SPZ5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.