UniProt ID | 14311_ARATH | |
---|---|---|
UniProt AC | Q9S9Z8 | |
Protein Name | 14-3-3-like protein GF14 omicron | |
Gene Name | GRF11 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 252 | |
Subcellular Localization | Nucleus . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated. | |
Protein Description | Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.. | |
Protein Sequence | MENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVFYYKMKGDYFRYLAEFKSGADREEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYYEILNSPERACHLAKRAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLEEGGEQSKGHNQQDEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
65 | Phosphorylation | RASWRILSSIEQKEE HHHHHHHHHHHHHHH | 27.22 | - | |
149 | Phosphorylation | REEAADLSLKAYEAA HHHHHHHHHHHHHHH | 28.50 | 19880383 | |
157 | Phosphorylation | LKAYEAATSSASTEL HHHHHHHHCCCCCCC | 30.20 | 23111157 | |
188 | Phosphorylation | FYYEILNSPERACHL HHHHHHCCHHHHHHH | 25.37 | - | |
234 | Phosphorylation | DNLTLWTSDLEEGGE CCCEEEECCCCCCCC | 28.72 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 14311_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 14311_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 14311_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of 14311_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...