MPK7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPK7_ARATH
• UniProt AC: Q39027
• Protein Name: Mitogen-activated protein kinase 7
• Gene Name: MPK7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 368
• Protein Description: MKK3-MPK7 module acts as a positive regulator of PR1 gene expression..
• Protein Sequence: MAMLVEPPNGIKQQGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSINRETNERVAIKKIHNVFENRVDALRTLRELKLLRHVRHENVIALKDVMLPANRSSFKDVYLVYELMDTDLHQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLARTSQGNEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECLNQLKLIINVVGSQQESDIRFIDNPKARRFIKSLPYSRGTHLSNLYPQANPLAIDLLQRMLVFDPTKRISVTDALLHPYMAGLFDPGSNPPAHVPISLDIDENMEEPVIREMMWNEMLYYHPEAEISNA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
191	Phosphorylation	QGNEQFMTEYVVTRW CCCHHHHHHHHHEEE	26.00	25561503
193	Phosphorylation	NEQFMTEYVVTRWYR CHHHHHHHHHEEECC	7.34	22074104
196	Phosphorylation	FMTEYVVTRWYRAPE HHHHHHHEEECCCCH	12.87	22074104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPK7_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
191	T	Phosphorylation	Dually phosphorylated on Thr-191 and Tyr-193, which activates the enzyme.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPK7_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of MPK7_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.