UniProt ID | ACCD_ARATH | |
---|---|---|
UniProt AC | P56765 | |
Protein Name | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic {ECO:0000255|HAMAP-Rule:MF_01395} | |
Gene Name | accD {ECO:0000255|HAMAP-Rule:MF_01395} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 488 | |
Subcellular Localization |
Plastid, chloroplast membrane Peripheral membrane protein. Plastid, chloroplast stroma . |
|
Protein Description | Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.. | |
Protein Sequence | MEKSWFNFMFSKGELEYRGELSKAMDSFAPGEKTTISQDRFIYDMDKNFYGWDERSSYSSSYSNNVDLLVSSKDIRNFISDDTFFVRDSNKNSYSIFFDKKKKIFEIDNDFSDLEKFFYSYCSSSYLNNRSKGDNDLHYDPYIKDTKYNCTNHINSCIDSYFRSYICIDNNFLIDSNNFNESYIYNFICSESGKIRESKNYKIRTNRNRSNLISSKDFDITQNYNQLWIQCDNCYGLMYKKVKMNVCEQCGHYLKMSSSERIELLIDPGTWNPMDEDMVSADPIKFHSKEEPYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFRFMGGSMGSVVGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKISSVLCDYQSSKKLFYISILTSPTTGGVTASFGMLGDIIIAEPYAYIAFAGKRVIEQTLKKAVPEGSQAAESLLRKGLLDAIVPRNLLKGVLSELFQLHAFFPLNTN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
448 | Phosphorylation | KKAVPEGSQAAESLL HHHCCCCHHHHHHHH | 18.25 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACCD_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACCD_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACCD_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACCD_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...