UniProt ID | E13A_ARATH | |
---|---|---|
UniProt AC | P33157 | |
Protein Name | Glucan endo-1,3-beta-glucosidase, acidic isoform | |
Gene Name | BG2 {ECO:0000303|PubMed:1824335} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 339 | |
Subcellular Localization | Endoplasmic reticulum . Secreted, extracellular space, apoplast . Secreted, cell wall . Exported in the apoplast and secreted to the cell wall under treatment with salicylic acid (SA). | |
Protein Description | Implicated in the defense of plants against pathogens (Probable). Not involved in plasmodesmal callose degradation and in the gating of plasmodesmata during tobamovirus infection. [PubMed: 23656331] | |
Protein Sequence | MSESRSLASPPMLMILLSLVIASFFNHTAGQIGVCYGMLGDTLPSPSDVVALYKQQNIQRMRLYGPDPGALAALRGSDIELILDVPSSDLERLASSQTEADKWVQENVQSYRDGVRFRYINVGNEVKPSVGGFLLQAMQNIENAVSGAGLEVKVSTAIATDTTTDTSPPSQGRFRDEYKSFLEPVIGFLASKQSPLLVNLYPYFSYMGDTANIHLDYALFTAQSTVDNDPGYSYQNLFDANLDSVYAALEKSGGGSLEIVVSETGWPTEGAVGTSVENAKTYVNNLIQHVKNGSPRRPGKAIETYIFAMFDENKKEPTYEKFWGLFHPDRQSKYEVNFN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Phosphorylation | NIQRMRLYGPDPGAL CCCEEEECCCCHHHH | 19.08 | 24299221 | |
95 | Phosphorylation | SDLERLASSQTEADK HHHHHHHCCCHHHHH | 27.80 | 24299221 | |
282 | Phosphorylation | SVENAKTYVNNLIQH CHHHHHHHHHHHHHH | 10.65 | 24299221 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of E13A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of E13A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of E13A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of E13A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...