dbPTM

E13A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	E13A_ARATH
UniProt AC	P33157
Protein Name	Glucan endo-1,3-beta-glucosidase, acidic isoform
Gene Name	BG2 {ECO:0000303\|PubMed:1824335}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	339
Subcellular Localization	Endoplasmic reticulum . Secreted, extracellular space, apoplast . Secreted, cell wall . Exported in the apoplast and secreted to the cell wall under treatment with salicylic acid (SA).
Protein Description	Implicated in the defense of plants against pathogens (Probable). Not involved in plasmodesmal callose degradation and in the gating of plasmodesmata during tobamovirus infection. [PubMed: 23656331]
Protein Sequence	MSESRSLASPPMLMILLSLVIASFFNHTAGQIGVCYGMLGDTLPSPSDVVALYKQQNIQRMRLYGPDPGALAALRGSDIELILDVPSSDLERLASSQTEADKWVQENVQSYRDGVRFRYINVGNEVKPSVGGFLLQAMQNIENAVSGAGLEVKVSTAIATDTTTDTSPPSQGRFRDEYKSFLEPVIGFLASKQSPLLVNLYPYFSYMGDTANIHLDYALFTAQSTVDNDPGYSYQNLFDANLDSVYAALEKSGGGSLEIVVSETGWPTEGAVGTSVENAKTYVNNLIQHVKNGSPRRPGKAIETYIFAMFDENKKEPTYEKFWGLFHPDRQSKYEVNFN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	NIQRMRLYGPDPGAL CCCEEEECCCCHHHH	19.08	24299221
95	Phosphorylation	SDLERLASSQTEADK HHHHHHHCCCHHHHH	27.80	24299221
282	Phosphorylation	SVENAKTYVNNLIQH CHHHHHHHHHHHHHH	10.65	24299221

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of E13A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of E13A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of E13A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of E13A_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of E13A_ARATH

Related Literatures of Post-Translational Modification