PMM_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PMM_ARATH
• UniProt AC: O80840
• Protein Name: Phosphomannomutase
• Gene Name: PMM
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 246
• Subcellular Localization: Cytoplasm.
• Protein Description: Involved in ascorbic acid biosynthesis and in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions..
• Protein Sequence: MAAKIPGVIALFDVDGTLTAPRKEATPELLDFIRELRKVVTIGVVGGSDLSKISEQLGKTVTNDYDYCFSENGLVAHKDGKSIGIQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQISFDVFPKGWDKTYCLQYLEDFSEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTVAKCKALFMS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
225	Phosphorylation	EIYESPKTIGHSVTS EEEECCCCCCCCCCC	35.26	23776212
229	Phosphorylation	SPKTIGHSVTSPDDT CCCCCCCCCCCCCCH	23.13	23776212
231	Phosphorylation	KTIGHSVTSPDDTVA CCCCCCCCCCCCHHH	37.24	23776212
232	Phosphorylation	TIGHSVTSPDDTVAK CCCCCCCCCCCHHHH	24.95	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PMM_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PMM_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PMM_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PMM_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.