PER51_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PER51_ARATH
• UniProt AC: Q9SZE7
• Protein Name: Peroxidase 51
• Gene Name: PER51
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 329
• Subcellular Localization: Secreted .
• Protein Description: Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue..
• Protein Sequence: MVVMNKTNLLLLILSLFLAINLSSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNLAGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTLGFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNVYYKNLQQGKGLFTSDQVLFTDSRSKPTVDLWANNGQLFNQAFISSMIKLGRVGVKTGSNGNIRRDCGAFN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
65	Phosphorylation	IPATLRLYFHDCFVN CCCHHHHHHHHHHHC	7.76	19880383
77	Phosphorylation	FVNGCDASVMIASTN HHCCCCEEEEEEECC	10.04	19880383
215	N-linked_Glycosylation	FNRLYNFNKTNNVDP HHHHHCCCCCCCCCC	46.75	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PER51_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PER51_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PER51_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PER51_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.