UniProt ID | PRN1_ARATH | |
---|---|---|
UniProt AC | Q9LX49 | |
Protein Name | Pirin-1 | |
Gene Name | PRN1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 287 | |
Subcellular Localization | Nucleus. | |
Protein Description | Involved in abscisic acid signal transduction. Plays a role in seed germination and early seedling development. Involved in the blue light (BL) signaling.. | |
Protein Sequence | MTYENNSVPRIVIKKVLAKLEKEGEGAVVRNGITKIDQKLLDPFVLLVEFSFSLSAGFPDHPHRGFESVTYMLQGGIIHKDPKGHKGTIQAGDVQWMTAGRGIIHSEFPEEEVNNGLQLWINLPSTEKMTEPKYKELSSLDIPRAEENGVEVKVIAGDSMGIKSPVYTRTPTMFLDFTLKPGSQTHQTVPESWTAFAYIIEGDEGVFGSLNSSAISAHHVVVFGPGDLVSVWNKSTSRSLRFLLIAGEPIGEPVVQCGPFVMNSQAEIDMAFDDYQNAKNGFEMAKC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTYENNSVP ------CCCCCCCCC | 39.27 | 22223895 | |
2 | Phosphorylation | ------MTYENNSVP ------CCCCCCCCC | 39.27 | 19880383 | |
3 | Phosphorylation | -----MTYENNSVPR -----CCCCCCCCCH | 18.50 | 19880383 | |
7 | Phosphorylation | -MTYENNSVPRIVIK -CCCCCCCCCHHHHH | 45.11 | 19880383 | |
139 | Phosphorylation | PKYKELSSLDIPRAE CCCHHHHCCCCCCHH | 42.56 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRN1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRN1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRN1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TCLOT_ARATH | AT5G42850 | physical | 21952135 | |
ATPO_ARATH | ATP5 | physical | 21952135 | |
SUI11_ARATH | AT4G27130 | physical | 21952135 | |
FRI2_ARATH | FER2 | physical | 21952135 | |
VOZ2_ARATH | VOZ2 | physical | 21952135 | |
P2A05_ARATH | PP2-A5 | physical | 21952135 | |
VOZ1_ARATH | VOZ1 | physical | 21952135 | |
UFC1_ARATH | AT1G27530 | physical | 21952135 | |
VAP22_ARATH | VAP27-2 | physical | 21952135 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...