| UniProt ID | PRN1_ARATH | |
|---|---|---|
| UniProt AC | Q9LX49 | |
| Protein Name | Pirin-1 | |
| Gene Name | PRN1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 287 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in abscisic acid signal transduction. Plays a role in seed germination and early seedling development. Involved in the blue light (BL) signaling.. | |
| Protein Sequence | MTYENNSVPRIVIKKVLAKLEKEGEGAVVRNGITKIDQKLLDPFVLLVEFSFSLSAGFPDHPHRGFESVTYMLQGGIIHKDPKGHKGTIQAGDVQWMTAGRGIIHSEFPEEEVNNGLQLWINLPSTEKMTEPKYKELSSLDIPRAEENGVEVKVIAGDSMGIKSPVYTRTPTMFLDFTLKPGSQTHQTVPESWTAFAYIIEGDEGVFGSLNSSAISAHHVVVFGPGDLVSVWNKSTSRSLRFLLIAGEPIGEPVVQCGPFVMNSQAEIDMAFDDYQNAKNGFEMAKC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MTYENNSVP ------CCCCCCCCC | 39.27 | 22223895 | |
| 2 | Phosphorylation | ------MTYENNSVP ------CCCCCCCCC | 39.27 | 19880383 | |
| 3 | Phosphorylation | -----MTYENNSVPR -----CCCCCCCCCH | 18.50 | 19880383 | |
| 7 | Phosphorylation | -MTYENNSVPRIVIK -CCCCCCCCCHHHHH | 45.11 | 19880383 | |
| 139 | Phosphorylation | PKYKELSSLDIPRAE CCCHHHHCCCCCCHH | 42.56 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRN1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRN1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRN1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCLOT_ARATH | AT5G42850 | physical | 21952135 | |
| ATPO_ARATH | ATP5 | physical | 21952135 | |
| SUI11_ARATH | AT4G27130 | physical | 21952135 | |
| FRI2_ARATH | FER2 | physical | 21952135 | |
| VOZ2_ARATH | VOZ2 | physical | 21952135 | |
| P2A05_ARATH | PP2-A5 | physical | 21952135 | |
| VOZ1_ARATH | VOZ1 | physical | 21952135 | |
| UFC1_ARATH | AT1G27530 | physical | 21952135 | |
| VAP22_ARATH | VAP27-2 | physical | 21952135 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
