UniProt ID | P2A05_ARATH | |
---|---|---|
UniProt AC | Q9C5Q9 | |
Protein Name | Protein PHLOEM PROTEIN 2-LIKE A5 | |
Gene Name | PP2A5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 411 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSGASSVSSICSSNVSLIPTGPQVFINFRGKDLRKGFMSFLKPALKKEKINVFIDEQEERGKYLISLFDTIGESKIALVIFSEGYCESHWCMDELVKIKEYMDQNRLIIIPIFYRLDLDVVKDLTGKFGDNFWDLVDKYQPEPKKLHKWTEALFSVCELFSLILPKHSDISDRDFVKSIVKAVKKVQKNFFQRRNGEIEYQDFSVPACKLTITMHESPNEEAVQVTVLNEFYQMKNQSPVPSYEFKFWVDLTRPKGNVFMIDARDLSIAWSEDSNHWTWLPLPNQNSNESVMEIAFLKSASWLDVAGKFDTRYLTPRTRYEVVFVVKLEYTFEWETLVKLKLDLPNTWEKPQEQSVDMFDYISDQWLDIPVGEFTTSKKNVGEISFAMYEHECQLWKSGLFVKGVTIRPKY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of P2A05_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P2A05_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P2A05_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P2A05_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ABI5_ARATH | ABI5 | physical | 24823379 | |
UBC17_ARATH | UBC17 | physical | 24823379 | |
RVE2_ARATH | RVE2 | physical | 24823379 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...