ATPO_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATPO_ARATH
• UniProt AC: Q96251
• Protein Name: ATP synthase subunit O, mitochondrial
• Gene Name: At5g13450
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 238
• Subcellular Localization: Mitochondrion . Mitochondrion inner membrane.
• Protein Description: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements..
• Protein Sequence: MANRFRSGISFFKTIAVTDSVSSVRSKSLFPALRTYATASAQTTANVKVPIALVGENGNFASWLYIAAVKMNSLEKIETDLSEMIEAMKTAPIFAQFTKDPSVPRGTRLAAIRDACDQAKFAEPTKNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEIIGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQMERLLREPVDFNNL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Sulfoxidation	LYIAAVKMNSLEKIE HHHHHHHHCCHHHHC	3.11	23289948
79	Phosphorylation	NSLEKIETDLSEMIE CCHHHHCCCHHHHHH	45.79	22092075
84	Sulfoxidation	IETDLSEMIEAMKTA HCCCHHHHHHHHHHC	2.77	23289948
88	Sulfoxidation	LSEMIEAMKTAPIFA HHHHHHHHHHCCCHH	2.28	23289948
90	Phosphorylation	EMIEAMKTAPIFAQF HHHHHHHHCCCHHHH	25.28	22092075
130	Phosphorylation	EPTKNFLSLLAENGK CCCHHHHHHHHHCCC	19.73	22092075
178	Phosphorylation	PAEEKELTETLQEII CHHHHHHHHHHHHHH	28.19	22092075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATPO_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATPO_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATPO_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ATPO_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.