dbPTM

UFC1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UFC1_ARATH
UniProt AC	Q9SXC8
Protein Name	Ubiquitin-fold modifier-conjugating enzyme 1
Gene Name	At1g27530
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	174
Subcellular Localization
Protein Description	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage..
Protein Sequence	MEGWDPNTKSTLTRIPLLTTKAGPRDGAAWTQRLKEEYKSLIAYTQMNKSNDNDWFRISASNPEGTRWTGKCWYVHNLLKYEFDLQFDIPITYPATAPELELPEIDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGAIKHKDDAATSAES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
47	Sulfoxidation	SLIAYTQMNKSNDND HHHHHCCCCCCCCCC	5.41	25693801
170	Phosphorylation	KHKDDAATSAES--- CCCCCCCCCCCC---	30.14	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UFC1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UFC1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UFC1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of UFC1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UFC1_ARATH

Related Literatures of Post-Translational Modification