SUI11_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SUI11_ARATH
• UniProt AC: P41568
• Protein Name: Protein translation factor SUI1 homolog 1
• Gene Name: At4g27130
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 113
• Protein Description: Probably involved in translation..
• Protein Sequence: MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSELDSQVP ------CCHHHHCCC	47.03	22223895
2	Phosphorylation	------MSELDSQVP ------CCHHHHCCC	47.03	23328941
6	Phosphorylation	--MSELDSQVPTAFD --CCHHHHCCCCCCC	45.78	23328941
43	Phosphorylation	QQRNGRKSLTTVQGL EECCCCCCCCHHHHH	29.59	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SUI11_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SUI11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SUI11_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SUI11_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.