FRI2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FRI2_ARATH
• UniProt AC: Q9SRL5
• Protein Name: Ferritin-2, chloroplastic
• Gene Name: FER2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 253
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation (By similarity)..
• Protein Sequence: MLHKASPALSLLSSGYTGGGNLFPPSRNSSNLLFSPSGSRFSVQAAKGTNTKSLTGVVFEPFEEVKKEMELVPTTPFVSLARHKFSDDSESAINDQINVEYNVSYVYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEMFMEYQNKRGGRVKLQSILMPVSEFDHEEKGDALHAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQVEAIKKISEYVAQLRRIGKGHGVWHFDQMLLNDEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
74	Phosphorylation	KEMELVPTTPFVSLA HHHCCCCCCCCHHHH	39.35	19880383
75	Phosphorylation	EMELVPTTPFVSLAR HHCCCCCCCCHHHHC	14.52	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FRI2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FRI2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FRI2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of FRI2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.