dbPTM

WRK18_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	WRK18_ARATH
UniProt AC	Q9C5T4
Protein Name	WRKY transcription factor 18
Gene Name	WRKY18
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	310
Subcellular Localization	Nucleus .
Protein Description	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Positively modulates defense-related gene expression and disease resistance..
Protein Sequence	MDGSSFLDISLDLNTNPFSAKLPKKEVSVLASTHLKRKWLEQDESASELREELNRVNSENKKLTEMLARVCESYNELHNHLEKLQSRQSPEIEQTDIPIKKRKQDPDEFLGFPIGLSSGKTENSSSNEDHHHHHQQHEQKNQLLSCKRPVTDSFNKAKVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLGPNASEGDATSQGGSSTVTLDLVNGCHRLALEKNERDNTMQEVLIQQMASSLTKDSKFTAALAAAISGRLMEQSRT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
86	Phosphorylation	NHLEKLQSRQSPEIE HHHHHHHHCCCCCCC	42.60	27545962
89	Phosphorylation	EKLQSRQSPEIEQTD HHHHHCCCCCCCCCC	24.32	27545962

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of WRK18_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of WRK18_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of WRK18_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WRK18_ARATH	WRKY18	physical	16603654
WRK40_ARATH	WRKY40	physical	16603654
WRK60_ARATH	WRKY60	physical	16603654
WRK18_ARATH	WRKY18	physical	21798944
WRK60_ARATH	WRKY60	genetic	25615824
WRK40_ARATH	WRKY40	genetic	25615824

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of WRK18_ARATH

Related Literatures of Post-Translational Modification