UniProt ID | WRK18_ARATH | |
---|---|---|
UniProt AC | Q9C5T4 | |
Protein Name | WRKY transcription factor 18 | |
Gene Name | WRKY18 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 310 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Positively modulates defense-related gene expression and disease resistance.. | |
Protein Sequence | MDGSSFLDISLDLNTNPFSAKLPKKEVSVLASTHLKRKWLEQDESASELREELNRVNSENKKLTEMLARVCESYNELHNHLEKLQSRQSPEIEQTDIPIKKRKQDPDEFLGFPIGLSSGKTENSSSNEDHHHHHQQHEQKNQLLSCKRPVTDSFNKAKVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLGPNASEGDATSQGGSSTVTLDLVNGCHRLALEKNERDNTMQEVLIQQMASSLTKDSKFTAALAAAISGRLMEQSRT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WRK18_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WRK18_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WRK18_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WRK18_ARATH | WRKY18 | physical | 16603654 | |
WRK40_ARATH | WRKY40 | physical | 16603654 | |
WRK60_ARATH | WRKY60 | physical | 16603654 | |
WRK18_ARATH | WRKY18 | physical | 21798944 | |
WRK60_ARATH | WRKY60 | genetic | 25615824 | |
WRK40_ARATH | WRKY40 | genetic | 25615824 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...