dbPTM

WRK60_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	WRK60_ARATH
UniProt AC	Q9SK33
Protein Name	Probable WRKY transcription factor 60
Gene Name	WRKY60
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	271
Subcellular Localization	Nucleus .
Protein Description	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity)..
Protein Sequence	MDYDPNTNPFDLHFSGKLPKREVSASASKVVEKKWLVKDEKRNMLQDEINRVNSENKKLTEMLARVCEKYYALNNLMEELQSRKSPESVNFQNKQLTGKRKQELDEFVSSPIGLSLGPIENITNDKATVSTAYFAAEKSDTSLTVKDGYQWRKYGQKITRDNPSPRAYFRCSFSPSCLVKKKVQRSAEDPSFLVATYEGTHNHTGPHASVSRTVKLDLVQGGLEPVEEKKERGTIQEVLVQQMASSLTKDPKFTAALATAISGRLIEHSRT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of WRK60_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of WRK60_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of WRK60_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of WRK60_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WRK18_ARATH	WRKY18	physical	16603654
WRK40_ARATH	WRKY40	physical	16603654
WRK60_ARATH	WRKY60	physical	16603654
RS102_ARATH	AT5G41520	physical	21798944
IMPA3_ARATH	MOS6	physical	21798944
WRK60_ARATH	WRKY60	physical	21798944
VATF_ARATH	AT4G02620	physical	21798944
FTSH2_ARATH	VAR2	physical	21798944
RS103_ARATH	AT5G52650	physical	21798944
CLPB3_ARATH	CLPB3	physical	21798944
IF4G1_ARATH	eIFiso4G1	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of WRK60_ARATH

Related Literatures of Post-Translational Modification