PIF4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PIF4_ARATH
• UniProt AC: Q8W2F3
• Protein Name: Transcription factor PIF4
• Gene Name: PIF4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 430
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor acting negatively in the phytochrome B signaling pathway. May regulate the expression of a subset of genes involved in cell expansion by binding to the G-box motif (By similarity). Activated by CRY1 and CRY2 in response to low blue light (LBL) by direct binding at chromatin on E-box variant 5'-CA[CT]GTG-3' to stimulate specific gene expression to adapt global physiology (e.g. hypocotyl elongation in low blue light). [PubMed: 26724867]
• Protein Sequence: MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTDKASILDEAIDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPMEMLRFSSPAGQQSQQPSSVPTKTTDGSRLDH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
112	Phosphorylation	SETVKPKSSPEPPQV CCCCCCCCCCCCCCE	60.70	25561503
113	Phosphorylation	ETVKPKSSPEPPQVM CCCCCCCCCCCCCEE	39.13	25561503
144	Phosphorylation	PKFRLTNSSSGIRET CCCCCCCCCCCCCCE	22.20	22631563
145	Phosphorylation	KFRLTNSSSGIRETE CCCCCCCCCCCCCEE	34.35	22631563
146	Phosphorylation	FRLTNSSSGIRETEM CCCCCCCCCCCCEEE	37.75	22631563
198	Phosphorylation	LNPNASSSSGGSSGC HCCCCCCCCCCCCCC	30.43	23572148
199	Phosphorylation	NPNASSSSGGSSGCS CCCCCCCCCCCCCCC	49.47	23572148
202	Phosphorylation	ASSSSGGSSGCSFGK CCCCCCCCCCCCCCH	27.38	23572148

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PIF4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PIF4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PIF4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIF7_ARATH	PIF7	genetic	18252845
PIF3_ARATH	PIF3	genetic	18252845
PIF5_ARATH	PIL6	genetic	18047474
PHYA_ARATH	PHYA	physical	12006496
PHYB_ARATH	PHYB	physical	12006496
HFR1_ARATH	HFR1	physical	19851283
FCA_ARATH	FCA	physical	25400039
DET1_ARATH	DET1	physical	25248553
PAR1_ARATH	PAR1	physical	22331621
BZR1_ARATH	BZR1	physical	22820378
ARFF_ARATH	ARF6	physical	24867218
WRK18_ARATH	WRKY18	physical	26293691
WRK40_ARATH	WRKY40	physical	26293691

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.