UniProt ID | PAR1_ARATH | |
---|---|---|
UniProt AC | Q9SJH0 | |
Protein Name | Transcription factor PAR1 | |
Gene Name | PAR1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 118 | |
Subcellular Localization | Nucleus . | |
Protein Description | Atypical bHLH transcription factor that acts as negative regulator of a variety of shade avoidance syndrome (SAS) responses, including seedling elongation and photosynthetic pigment accumulation. Acts as direct transcriptional repressor of two auxin-responsive genes, SAUR15 and SAUR68. May function in integrating shade and hormone transcriptional networks in response to light and auxin changes.. | |
Protein Sequence | MEETLATPDATRRSLSPSCSATVKSRAAGFERRTKRRLSETNASVREDREEAEEEEDEVKEKIEALQRIIPGGAALGVDALFEETAGYILSLQCQIKTIKVLTSFLQRIDQEDMKFGG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAR1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAR1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAR1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PAR1_ARATH | PAR1 | physical | 21205034 | |
FRL4A_ARATH | AT3G22440 | physical | 21798944 | |
UNE12_ARATH | UNE12 | physical | 21798944 | |
MED7B_ARATH | AT5G03500 | physical | 21798944 | |
HEC2_ARATH | HEC2 | physical | 21798944 | |
ALC_ARATH | ALC | physical | 21798944 | |
IND_ARATH | IND | physical | 21798944 | |
BEE2_ARATH | BEE2 | physical | 21798944 | |
BRE1A_ARATH | HUB1 | physical | 21798944 | |
PIF4_ARATH | PIF4 | physical | 22331621 | |
PRE1_ARATH | PRE1 | physical | 22331621 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...