PRE1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRE1_ARATH
• UniProt AC: Q9FLE9
• Protein Name: Transcription factor PRE1
• Gene Name: PRE1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 92
• Subcellular Localization: Nucleus .
• Protein Description: Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Binds IBH1, forming a pair of antagonistic bHLH transcription factors that function downstream of BZR1 to mediate brassinosteroid regulation of cell elongation. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development..
• Protein Sequence: MSNRRSRQSSSAPRISDNQMIDLVSKLRQILPEIGQRRRSDKASASKVLQETCNYIRNLNREVDNLSERLSQLLESVDEDSPEAAVIRSLLM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	Phosphorylation	RSDKASASKVLQETC HCCHHHHHHHHHHHH		19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRE1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRE1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRE1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PRE1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.