PIF5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PIF5_ARATH
• UniProt AC: Q84LH8
• Protein Name: Transcription factor PIF5
• Gene Name: PIF5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 444
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor acting negatively in the phytochrome B signaling pathway to promote the shade-avoidance response. Regulates PHYB abundance at the post-transcriptional level, possibly via the ubiquitin-proteasome pathway. Promotes ethylene activity in the dark. May regulate the expression of a subset of genes by binding to the G-box motif. Might be involved in the integration of light-signals to control both circadian and photomorphogenic processes. Activated by CRY1 and CRY2 in response to low blue light (LBL) by direct binding at chromatin on E-box variant 5'-CA[CT]GTG-3' to stimulate specific gene expression to adapt global physiology (e.g. hypocotyl elongation in low blue light). [PubMed: 26724867]
• Protein Sequence: MEQVFADWNFEDNFHMSTNKRSIRPEDELVELLWRDGQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALDDQETVSWIQYPPDDVIDPFESEFSSHFFSSIDHLGGPEKPRTIEETVKHEAQAMAPPKFRSSVITVGPSHCGSNQSTNIHQATTLPVSMSDRSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSVTIDRKRKHVMDADQESVSQSDIGLTSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTDKASILDEAIDYLKSLQMQLQVMWMGSGMAAAAAAAASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNRSAPQNHPGLVCQNPVQLQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADMLGFGSPAGPQSQLSAPATTDSLHMGKIG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
177	Phosphorylation	PVSMSDRSKNVEERL CCCHHHCCCCHHHHH	33.31	-
205	Phosphorylation	RNNKETVSGTSVTID CCCCCEECCEEEEEE	43.72	25561503
207	Phosphorylation	NKETVSGTSVTIDRK CCCEECCEEEEEECC	16.71	25561503
208	Phosphorylation	KETVSGTSVTIDRKR CCEECCEEEEEECCC	22.31	25561503
210	Phosphorylation	TVSGTSVTIDRKRKH EECCEEEEEECCCCC	19.54	25561503
437	Phosphorylation	SAPATTDSLHMGKIG CCCCCCCCCCCCCCC	20.34	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PIF5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PIF5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PIF5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIF3_ARATH	PIF3	physical	15356333
PHYB_ARATH	PHYB	genetic	17519251
PHYB_ARATH	PHYB	genetic	18065691
PIF4_ARATH	PIF4	genetic	18047474
PHYB_ARATH	PHYB	physical	17827270
HFR1_ARATH	HFR1	physical	19851283
PIF1_ARATH	PIL5	physical	21928113
DET1_ARATH	DET1	physical	25248553

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.