| UniProt ID | 14339_ARATH | |
|---|---|---|
| UniProt AC | Q96299 | |
| Protein Name | 14-3-3-like protein GF14 mu | |
| Gene Name | GRF9 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 263 | |
| Subcellular Localization | Nucleus . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated. | |
| Protein Description | Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.. | |
| Protein Sequence | MGSGKERDTFVYLAKLSEQAERYEEMVESMKSVAKLNVDLTVEERNLLSVGYKNVIGSRRASWRIFSSIEQKEAVKGNDVNVKRIKEYMEKVELELSNICIDIMSVLDEHLIPSASEGESTVFFNKMKGDYYRYLAEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNFSVFYYEIMNAPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISEEGGDDAHKTNGSAKPGAGGDDAE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MGSGKERDTF -----CCCCCCCHHH | 45.45 | 26091701 | |
| 67 | Phosphorylation | RASWRIFSSIEQKEA HHHHHHHHCHHHHHH | 28.21 | - | |
| 207 | Phosphorylation | QAFDEAISELDTLNE HHHHHHHHHHHCCCH | 38.87 | 30291188 | |
| 211 | Phosphorylation | EAISELDTLNEESYK HHHHHHHCCCHHHHC | 44.07 | - | |
| 232 | Phosphorylation | QLLRDNLTLWTSDIS HHHHCCCEEEECCCH | 26.89 | 23776212 | |
| 235 | Phosphorylation | RDNLTLWTSDISEEG HCCCEEEECCCHHHC | 21.45 | 23776212 | |
| 236 | Phosphorylation | DNLTLWTSDISEEGG CCCEEEECCCHHHCC | 22.74 | 23776212 | |
| 239 | Phosphorylation | TLWTSDISEEGGDDA EEEECCCHHHCCCCH | 34.29 | 30291188 | |
| 249 | Phosphorylation | GGDDAHKTNGSAKPG CCCCHHHCCCCCCCC | 34.64 | 23776212 | |
| 252 | Phosphorylation | DAHKTNGSAKPGAGG CHHHCCCCCCCCCCC | 34.88 | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 14339_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 14339_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 14339_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CNG13_ARATH | CNGC13 | physical | 22737156 | |
| PUP21_ARATH | AT4G18220 | physical | 22737156 | |
| FB316_ARATH | AT1G61340 | physical | 22920997 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-239, AND MASSSPECTROMETRY. | |
| "Phosphoproteomic analysis of nuclei-enriched fractions fromArabidopsis thaliana."; Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A.,Andreasson E., Rathjen J.P., Peck S.C.; J. Proteomics 72:439-451(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-239, AND MASSSPECTROMETRY. | |
