UniProt ID | TAZ_HUMAN | |
---|---|---|
UniProt AC | Q16635 | |
Protein Name | Tafazzin | |
Gene Name | TAZ | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization |
Isoform 1: Membrane Single-pass membrane protein. Isoform 2: Cytoplasm . Isoform 3: Membrane Single-pass membrane protein. Isoform 4: Membrane Single-pass membrane protein. Isoform 5: Membrane Single-pass membrane protein. Isoform 6: Cytoplasm . |
|
Protein Description | Some isoforms may be involved in cardiolipin (CL) metabolism.. | |
Protein Sequence | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
56 | Ubiquitination | VLYELIEKRGPATPL HHHHHHHHHCCCCCE | 56.51 | - | |
135 | Ubiquitination | FQAENEGKGVLDTGR EECCCCCCCCCCCCC | 39.40 | - | |
149 | Acetylation | RHMPGAGKRREKGDG CCCCCCCCCCCCCCC | 47.99 | 30592807 | |
160 | Ubiquitination | KGDGVYQKGMDFILE CCCCCCCCCHHHHHH | 38.22 | - | |
264 | Ubiquitination | KSAVEMRKALTDFIQ CCHHHHHHHHHHHHH | 46.57 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAZ_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAZ_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAZ_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...