UniProt ID | ANR46_HUMAN | |
---|---|---|
UniProt AC | Q86W74 | |
Protein Name | Ankyrin repeat domain-containing protein 46 | |
Gene Name | ANKRD46 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 232 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYRRTLRLGSFARQDRSRIQAI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
116 | Ubiquitination | ATPLVLAKRRGVNKD CCHHHHHHHCCCCHH | 38.17 | - | |
137 | Ubiquitination | SLEEQEVKGFNRGTH HHHHHHCCCCCCCCC | 57.96 | 21890473 | |
137 (in isoform 1) | Ubiquitination | - | 57.96 | 21890473 | |
137 (in isoform 2) | Ubiquitination | - | 57.96 | 21890473 | |
146 | Ubiquitination | FNRGTHSKLETMQTA CCCCCCHHHHHHHHH | 42.62 | - | |
215 | Phosphorylation | GIAYYRRTLRLGSFA HHHHHHHHHHHHHHH | 13.77 | 113324987 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANR46_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANR46_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANR46_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ANR46_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...