UniProt ID | CAH11_HUMAN | |
---|---|---|
UniProt AC | O75493 | |
Protein Name | Carbonic anhydrase-related protein 11 | |
Gene Name | CA11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 328 | |
Subcellular Localization | Secreted . | |
Protein Description | Does not have a catalytic activity.. | |
Protein Sequence | MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MGAAARLSAPRALVL CCHHHHCCHHHHHHH | 30.58 | 24719451 | |
118 | N-linked_Glycosylation | PAPRPVVNVSGGPLL CCCCCEEEECCCCEE | 23.59 | 16335952 | |
131 | Phosphorylation | LLYSHRLSELRLLFG EEEECCHHHHHHHHC | 34.24 | 29496963 | |
170 | N-linked_Glycosylation | FNQELYGNFSAASRG CCHHHHCCCCHHHCC | 17.72 | UniProtKB CARBOHYD | |
260 | N-linked_Glycosylation | ILIDRALNITSLQMH HHHHCCCCCHHHHHH | 34.21 | UniProtKB CARBOHYD | |
328 | Dimethylation | VDGVPHGR------- ECCCCCCC------- | 40.09 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAH11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAH11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAH11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BIRC6_HUMAN | BIRC6 | physical | 26186194 | |
P20D2_HUMAN | PM20D2 | physical | 26186194 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00909 | Zonisamide |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-118, AND MASSSPECTROMETRY. |