dbPTM

LMF1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LMF1_HUMAN
UniProt AC	Q96S06
Protein Name	Lipase maturation factor 1
Gene Name	LMF1
Organism	Homo sapiens (Human).
Sequence Length	567
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Involved in the maturation of specific proteins in the endoplasmic reticulum. Required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway. Each LMF1 molecule chaperones 50 or more molecules of LPL..
Protein Sequence	MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLETGFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDFHYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQAVLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFGSVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVILQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRGWPLPGPL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MRPDSPTMAAPAES -CCCCCCCCCCCHHH	24.32	21888424
14	Phosphorylation	TMAAPAESLRRRKTG CCCCCHHHHHHCCCC	29.31	28355574
20	Phosphorylation	ESLRRRKTGYSDPEP HHHHHCCCCCCCCCC	39.27	28796482
22	Phosphorylation	LRRRKTGYSDPEPES HHHCCCCCCCCCCCC	18.35	28796482
23	Phosphorylation	RRRKTGYSDPEPESP HHCCCCCCCCCCCCC	48.29	28796482
29	Phosphorylation	YSDPEPESPPAPGRG CCCCCCCCCCCCCCC	47.07	21815630
40	Phosphorylation	PGRGPAGSPAHLHTG CCCCCCCCCCCCCCC	22.48	23909892
46	Phosphorylation	GSPAHLHTGTFWLTR CCCCCCCCCHHHHHH	44.25	28787133
48	Phosphorylation	PAHLHTGTFWLTRIV CCCCCCCHHHHHHHH	16.88	28787133
52	Phosphorylation	HTGTFWLTRIVLLKA CCCHHHHHHHHHHHH	14.67	23909892
92	Ubiquitination	LPCRVFLKNFQQYFQ CCHHHHHHHHHHHHC	44.23	-
253	Phosphorylation	PMPNPVAYYLHHSPW CCCCCCEEECCCCCC	13.54	23663014
254	Phosphorylation	MPNPVAYYLHHSPWW CCCCCEEECCCCCCH	6.99	23663014
258	Phosphorylation	VAYYLHHSPWWFHRF CEEECCCCCCHHHHH	16.09	23663014
388	Phosphorylation	PVVLNLLSSRQVMNT HHHHHHHCCCCHHHH	27.00	24719451
389	Phosphorylation	VVLNLLSSRQVMNTH HHHHHHCCCCHHHHC	27.05	24719451
522	Phosphorylation	EHYRYKFSRPGGRHA CCEEEEECCCCCCCC	33.15	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LMF1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LMF1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LMF1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LMF1_HUMAN !!

Drug and Disease Associations

Kegg Disease
H01101	Combined lipase deficiency (CLD)
OMIM Disease
246650	Combined lipase deficiency (CLD)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LMF1_HUMAN

Related Literatures of Post-Translational Modification