| UniProt ID | BTD_HUMAN | |
|---|---|---|
| UniProt AC | P43251 | |
| Protein Name | Biotinidase | |
| Gene Name | BTD | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 543 | |
| Subcellular Localization | Secreted, extracellular space. | |
| Protein Description | Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation.. | |
| Protein Sequence | MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Ubiquitination | ----MAHAHIQGGRR ----CCCCCCCCCCC | 7.61 | - | |
| 24 (in isoform 2) | Phosphorylation | - | 12.79 | 26434776 | |
| 119 | N-linked_Glycosylation | EDGIHGFNFTRTSIY CCCCCCCCCCCCCCE | 41.81 | 17623646 | |
| 121 | N-linked_Glycosylation | GIHGFNFTRTSIYPF CCCCCCCCCCCCEEC | 33.86 | 16335952 | |
| 121 | N-linked_Glycosylation | GIHGFNFTRTSIYPF CCCCCCCCCCCCEEC | 33.86 | 16335952 | |
| 150 | N-linked_Glycosylation | CLEPHRFNDTEVLQR CCCCCCCCCHHHHHH | 56.08 | 19139490 | |
| 152 | N-linked_Glycosylation | EPHRFNDTEVLQRLS CCCCCCCHHHHHHHH | 29.15 | 16335952 | |
| 152 | N-linked_Glycosylation | EPHRFNDTEVLQRLS CCCCCCCHHHHHHHH | 29.15 | 16335952 | |
| 159 | Phosphorylation | TEVLQRLSCMAIRGD HHHHHHHHHHHHCCC | 12.20 | 22210691 | |
| 175 | Phosphorylation | FLVANLGTKEPCHSS EEEEECCCCCCCCCC | 35.09 | 22210691 | |
| 203 | N-linked_Glycosylation | TNVVFSNNGTLVDRY CEEEECCCCCEEEHH | 43.56 | 16335952 | |
| 205 | N-linked_Glycosylation | VVFSNNGTLVDRYRK EEECCCCCEEEHHHH | 26.23 | 16335952 | |
| 340 | Ubiquitination | IIAQVAKNPVGLIGA EEEEECCCCCCEECC | 27.10 | 29967540 | |
| 349 | N-linked_Glycosylation | VGLIGAENATGETDP CCEECCCCCCCCCCC | 42.12 | 19159218 | |
| 351 | N-linked_Glycosylation | LIGAENATGETDPSH EECCCCCCCCCCCCH | 47.32 | 16335952 | |
| 351 | N-linked_Glycosylation | LIGAENATGETDPSH EECCCCCCCCCCCCH | 47.32 | 16335952 | |
| 353 | Ubiquitination | GAENATGETDPSHSK CCCCCCCCCCCCHHH | 45.76 | 29967540 | |
| 362 | Ubiquitination | DPSHSKFLKILSGDP CCCHHHHHHHHCCCC | 3.76 | - | |
| 370 | Phosphorylation | KILSGDPYCEKDAQE HHHCCCCCCCCCCCE | 20.27 | 30576142 | |
| 375 | Ubiquitination | DPYCEKDAQEVHCDE CCCCCCCCCEECCCH | 20.64 | - | |
| 402 | N-linked_Glycosylation | HSEMMYDNFTLVPVW CCHHCCCCEEEEEEC | 17.83 | 16335952 | |
| 404 | N-linked_Glycosylation | EMMYDNFTLVPVWGK HHCCCCEEEEEECCC | 32.85 | 16335952 | |
| 489 | N-linked_Glycosylation | FEFHLWGNFSTSYIF EEEEEECCCCCCCEE | 19.00 | UniProtKB CARBOHYD | |
| 524 | Phosphorylation | DHYFLRKSRLSSGLV CCEEEHHHHHHHHHH | 31.83 | - | |
| 527 | Phosphorylation | FLRKSRLSSGLVTAA EEHHHHHHHHHHHHH | 22.65 | 29449344 | |
| 528 | Phosphorylation | LRKSRLSSGLVTAAL EHHHHHHHHHHHHHH | 40.51 | 29449344 | |
| 532 | Phosphorylation | RLSSGLVTAALYGRL HHHHHHHHHHHHHHH | 15.97 | 29449344 | |
| 536 | Phosphorylation | GLVTAALYGRLYERD HHHHHHHHHHHHCCC | 8.75 | 29449344 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BTD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BTD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BTD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYO1D_HUMAN | MYO1D | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 253260 | Biotinidase deficiency (BTD deficiency) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-119; ASN-150; ASN-349 ANDASN-402, AND MASS SPECTROMETRY. | |
| "Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-119; ASN-150; ASN-203;ASN-349 AND ASN-402, AND MASS SPECTROMETRY. | |
