UniProt ID | LEG3_HUMAN | |
---|---|---|
UniProt AC | P17931 | |
Protein Name | Galectin-3 | |
Gene Name | LGALS3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 250 | |
Subcellular Localization | Cytoplasm. Nucleus. Secreted. Secreted by a non-classical secretory pathway and associates with the cell surface. | |
Protein Description | Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells.. | |
Protein Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADNFSLHD ------CCCCCCHHH | 22.06 | - | |
6 | Phosphorylation | --MADNFSLHDALSG --CCCCCCHHHHHCC | 30.92 | 8253806 | |
12 | Phosphorylation | FSLHDALSGSGNPNP CCHHHHHCCCCCCCC | 32.41 | 8253806 | |
79 | Phosphorylation | GAPAPGVYPGPPSGP CCCCCCCCCCCCCCC | 14.37 | 20600357 | |
107 | Phosphorylation | AYPATGPYGAPAGPL CCCCCCCCCCCCCCE | 27.54 | 20600357 | |
118 | Phosphorylation | AGPLIVPYNLPLPGG CCCEEEECCCCCCCC | 20.59 | 20600357 | |
133 | Phosphorylation | VVPRMLITILGTVKP HHHHHEEEHHEECCC | 13.24 | 20068231 | |
137 | Phosphorylation | MLITILGTVKPNANR HEEEHHEECCCCCCE | 23.16 | 20068231 | |
175 | Phosphorylation | RRVIVCNTKLDNNWG CEEEEECCCCCCCCC | 28.05 | - | |
176 | Acetylation | RVIVCNTKLDNNWGR EEEEECCCCCCCCCH | 39.59 | 26051181 | |
176 | Ubiquitination | RVIVCNTKLDNNWGR EEEEECCCCCCCCCH | 39.59 | - | |
176 | Malonylation | RVIVCNTKLDNNWGR EEEEECCCCCCCCCH | 39.59 | 26320211 | |
188 | Phosphorylation | WGREERQSVFPFESG CCHHHHCCEEECCCC | 31.76 | 26657352 | |
196 | Acetylation | VFPFESGKPFKIQVL EEECCCCCCEEEEEE | 57.47 | 26051181 | |
196 | Malonylation | VFPFESGKPFKIQVL EEECCCCCCEEEEEE | 57.47 | 26320211 | |
196 | Ubiquitination | VFPFESGKPFKIQVL EEECCCCCCEEEEEE | 57.47 | - | |
210 | Ubiquitination | LVEPDHFKVAVNDAH EECCCCEEEEECHHH | 26.34 | - | |
210 | 2-Hydroxyisobutyrylation | LVEPDHFKVAVNDAH EECCCCEEEEECHHH | 26.34 | - | |
221 | Phosphorylation | NDAHLLQYNHRVKKL CHHHHHHHHHHHHHH | 16.95 | 28152594 | |
227 | Ubiquitination | QYNHRVKKLNEISKL HHHHHHHHHHHHHHC | 54.40 | - | |
227 | Malonylation | QYNHRVKKLNEISKL HHHHHHHHHHHHHHC | 54.40 | 26320211 | |
247 | Phosphorylation | IDLTSASYTMI---- CCCCCCEEECC---- | 10.47 | 18083107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
6 | S | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
6 | S | Phosphorylation | Kinase | CK1A | P97633 | PSP |
12 | S | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
79 | Y | Phosphorylation | Kinase | ABL1 | P00519 | GPS |
79 | Y | Phosphorylation | Kinase | ABL2 | P42684 | GPS |
107 | Y | Phosphorylation | Kinase | ABL1 | P00519 | GPS |
118 | Y | Phosphorylation | Kinase | ABL1 | P00519 | GPS |
118 | Y | Phosphorylation | Kinase | ABL2 | P42684 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEG3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEG3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6and serine 12 in vivo and by casein kinase I."; Huflejt M.E., Turck C.W., Lindstedt R., Barondes S.H., Leffler H.; J. Biol. Chem. 268:26712-26718(1993). Cited for: PHOSPHORYLATION AT SER-6 AND SER-12. |