T179B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: T179B_HUMAN
• UniProt AC: Q7Z7N9
• Protein Name: Transmembrane protein 179B
• Gene Name: TMEM179B
• Organism: Homo sapiens (Human).
• Sequence Length: 219
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAPSLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACILRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVLVLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	NGSSLALSRPSAPSL CCCCCCCCCCCCCCH	36.22	24719451
194	Phosphorylation	WKSEATPYRPLERGD HCCCCCCCCCCCCCC	22.10	27642862
205	Phosphorylation	ERGDPEWSSETDALV CCCCCCCCCCCHHHC	19.34	30266825
206	Phosphorylation	RGDPEWSSETDALVG CCCCCCCCCCHHHCC	45.66	30266825
208	Phosphorylation	DPEWSSETDALVGSR CCCCCCCCHHHCCCC	28.64	30266825
214	Phosphorylation	ETDALVGSRLSHS-- CCHHHCCCCCCCC--	23.67	25159151
217	Phosphorylation	ALVGSRLSHS----- HHCCCCCCCC-----	22.15	25159151
219	Phosphorylation	VGSRLSHS------- CCCCCCCC-------	38.24	30108239

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of T179B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of T179B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of T179B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of T179B_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-206, AND MASSSPECTROMETRY.
PubMed: 19690332