| UniProt ID | MLP3A_HUMAN | |
|---|---|---|
| UniProt AC | Q9H492 | |
| Protein Name | Microtubule-associated proteins 1A/1B light chain 3A | |
| Gene Name | MAP1LC3A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 121 | |
| Subcellular Localization |
Cytoplasm, cytoskeleton. Endomembrane system Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane Lipid-anchor. Cytoplasmic vesicle, autophagosome . LC3-II binds to the autophagic membranes. |
|
| Protein Description | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). [PubMed: 20713600] | |
| Protein Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 (in isoform 2) | Phosphorylation | - | 12.55 | 22210691 | |
| 8 (in isoform 2) | Phosphorylation | - | 45.65 | 22210691 | |
| 12 | Phosphorylation | RPFKQRRSFADRCKE CCHHHHHHHHHHHHH | 27.29 | 24290141 | |
| 42 | Ubiquitination | IERYKGEKQLPVLDK EEECCCCCCCCCCCC | 66.84 | 27667366 | |
| 46 | Ubiquitination | KGEKQLPVLDKTKFL CCCCCCCCCCCCCCC | 17.14 | 33845483 | |
| 49 | Acetylation | KQLPVLDKTKFLVPD CCCCCCCCCCCCCCC | 49.83 | 77115235 | |
| 49 | Ubiquitination | KQLPVLDKTKFLVPD CCCCCCCCCCCCCCC | 49.83 | 33845483 | |
| 51 | Acetylation | LPVLDKTKFLVPDHV CCCCCCCCCCCCCCC | 42.30 | 72586885 | |
| 51 | Ubiquitination | LPVLDKTKFLVPDHV CCCCCCCCCCCCCCC | 42.30 | 22817900 | |
| 53 | Ubiquitination | VLDKTKFLVPDHVNM CCCCCCCCCCCCCCH | 6.11 | 33845483 | |
| 55 | Ubiquitination | DKTKFLVPDHVNMSE CCCCCCCCCCCCHHH | 28.30 | 22817900 | |
| 92 | Phosphorylation | QHSMVSVSTPIADIY CCCCEEEECCHHHHH | 22.44 | - | |
| 103 | Ubiquitination | ADIYEQEKDEDGFLY HHHHHHHCCCCCCEE | 67.14 | 27667366 | |
| 110 | Ubiquitination | KDEDGFLYMVYASQE CCCCCCEEEEEEECC | 5.14 | 22817900 | |
| 112 | Ubiquitination | EDGFLYMVYASQETF CCCCEEEEEEECCCC | 1.97 | 22817900 | |
| 120 | Phosphatidylethanolamine amidation | YASQETFGF------ EEECCCCCC------ | 34.47 | 15187094 | |
| 144 | Ubiquitination | ------------------------------ ------------------------------ | 27667366 | ||
| 151 | Ubiquitination | ------------------------------------- ------------------------------------- | 22817900 | ||
| 153 | Ubiquitination | --------------------------------------- --------------------------------------- | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 12 | S | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
| 12 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 12 | S | Phosphorylation |
| 20713600 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLP3A_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
