| UniProt ID | GBRL1_HUMAN | |
|---|---|---|
| UniProt AC | Q9H0R8 | |
| Protein Name | Gamma-aminobutyric acid receptor-associated protein-like 1 | |
| Gene Name | GABARAPL1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 117 | |
| Subcellular Localization |
Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane Lipid-anchor. Endoplasmic reticulum. Golgi apparatus. Cytoplasmic vesicle, autophagosome. |
|
| Protein Description | Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.. | |
| Protein Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MKFQYKEDHPFE ---CCCCCCCCCCCC | 21.34 | - | |
| 6 | Ubiquitination | --MKFQYKEDHPFEY --CCCCCCCCCCCCC | 45.97 | - | |
| 6 | Acetylation | --MKFQYKEDHPFEY --CCCCCCCCCCCCC | 45.97 | 27452117 | |
| 15 | Ubiquitination | DHPFEYRKKEGEKIR CCCCCCCHHHHHHHH | 55.03 | - | |
| 23 | Ubiquitination | KEGEKIRKKYPDRVP HHHHHHHHHCCCCCC | 61.20 | - | |
| 24 | Ubiquitination | EGEKIRKKYPDRVPV HHHHHHHHCCCCCCE | 52.76 | 21890473 | |
| 24 | Ubiquitination | EGEKIRKKYPDRVPV HHHHHHHHCCCCCCE | 52.76 | 21890473 | |
| 28 | Methylation | IRKKYPDRVPVIVEK HHHHCCCCCCEEEEE | 30.09 | - | |
| 35 | Acetylation | RVPVIVEKAPKARVP CCCEEEEECCCCCCC | 60.12 | 130337 | |
| 35 | Ubiquitination | RVPVIVEKAPKARVP CCCEEEEECCCCCCC | 60.12 | - | |
| 46 | Ubiquitination | ARVPDLDKRKYLVPS CCCCCCCCCCEECCC | 59.07 | - | |
| 49 | Phosphorylation | PDLDKRKYLVPSDLT CCCCCCCEECCCCCC | 19.57 | - | |
| 56 | Phosphorylation | YLVPSDLTVGQFYFL EECCCCCCHHHHHHH | 27.81 | - | |
| 61 | Phosphorylation | DLTVGQFYFLIRKRI CCCHHHHHHHEECCC | 6.92 | - | |
| 116 | Phosphatidylethanolamine amidation | YSDESVYGK------ ECCCCCCCC------ | 27.35 | 20404487 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBRL1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBRL1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBRL1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
