| UniProt ID | CC14B_HUMAN | |
|---|---|---|
| UniProt AC | O60729 | |
| Protein Name | Dual specificity protein phosphatase CDC14B | |
| Gene Name | CDC14B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 498 | |
| Subcellular Localization | Nucleus, nucleolus. Nucleus, nucleoplasm. Following DNA damage, translocates from the nucleolus to the nucleoplasm and interacts with FZR1/CDH1. | |
| Protein Description | Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylates SIRT2 around early anaphase. Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases.. | |
| Protein Sequence | MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | KRKSERRSSWAAAPP CCHHHHHHHCCCCCC | 36.13 | - | |
| 10 | Phosphorylation | RKSERRSSWAAAPPC CHHHHHHHCCCCCCC | 20.94 | - | |
| 18 | Phosphorylation | WAAAPPCSRRCSSTS CCCCCCCCCCCCCCC | 28.65 | - | |
| 22 | Phosphorylation | PPCSRRCSSTSPGVK CCCCCCCCCCCCCCH | 34.53 | - | |
| 62 | Phosphorylation | RLCFAILYSRPKSAS HHHHHHHHCCCCCCC | 9.12 | 29083192 | |
| 63 | Phosphorylation | LCFAILYSRPKSASN HHHHHHHCCCCCCCC | 38.37 | 24719451 | |
| 110 | Phosphorylation | KINKKLKSITMLRKK HHCHHHHHHHHHHHH | 33.46 | 22964224 | |
| 112 | Phosphorylation | NKKLKSITMLRKKIV CHHHHHHHHHHHHHE | 19.76 | 22964224 | |
| 147 | Phosphorylation | MVIYLGRTPEEAYRI HHHHHCCCHHHHHEE | 33.00 | - | |
| 160 | Phosphorylation | RILIFGETSYIPFRD EEEEECCCCEECHHH | 27.49 | - | |
| 426 | Phosphorylation | DDEINGVTQGDRLRA CCCCCCCCHHHHHHH | 28.38 | - | |
| 489 | Phosphorylation | KSSVKSLSISRTKTV CCCCCEEEECCCEEC | 26.13 | 24719451 | |
| 495 | Phosphorylation | LSISRTKTVLR---- EEECCCEECCC---- | 24.94 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC14B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC14B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC14B_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
