UniProt ID | LY65B_HUMAN | |
---|---|---|
UniProt AC | Q8NDX9 | |
Protein Name | Lymphocyte antigen 6 complex locus protein G5b | |
Gene Name | LY6G5B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 201 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | ISGSEKCTISSSSLC CCCCCCEEECCCCEE | 34.65 | 29759185 | |
79 | Phosphorylation | GCGQYISYRCQEKRN CCCCEEEEEHHHHCC | 13.07 | - | |
141 | N-linked_Glycosylation | QWFYQALNLSLPLPN HHHHHHHCCCCCCCC | 30.51 | UniProtKB CARBOHYD | |
183 | N-linked_Glycosylation | RRMYLFLNSSGLLVL HHHHHHHCCCCCEEE | 27.13 | UniProtKB CARBOHYD | |
185 | Phosphorylation | MYLFLNSSGLLVLPQ HHHHHCCCCCEEECC | 32.18 | - | |
197 | Phosphorylation | LPQAGLLTPHPS--- ECCCCCCCCCCC--- | 25.29 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LY65B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LY65B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LY65B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LY65B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...