| UniProt ID | MD2L1_MOUSE | |
|---|---|---|
| UniProt AC | Q9Z1B5 | |
| Protein Name | Mitotic spindle assembly checkpoint protein MAD2A | |
| Gene Name | Mad2l1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 205 | |
| Subcellular Localization | Nucleus. Chromosome, centromere, kinetochore. Cytoplasm. Cytoplasm, cytoskeleton, spindle pole. Recruited by MAD1L1 to unattached kinetochores (By similarity). Recruited to the nuclear pore complex by TPR during interphase (By similarity). Recruited | |
| Protein Description | Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate (By similarity).. | |
| Protein Sequence | MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPELIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEEVRLRSFTTTIHKVNSMVAYKTPVND | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAQQLAREQ ------CHHHHHHHC | 13.06 | - | |
| 108 | Acetylation | QFDIECDKTAKEEGV EEEECCCCHHHHHCC | 63.14 | 23806337 | |
| 130 | Phosphorylation | AIQDEIRSVIRQITA HHHHHHHHHHHHHHH | 27.79 | 22067460 | |
| 170 | Phosphorylation | VPEKWEESGPQFITN CCCHHHHHCCCEECC | 44.23 | - | |
| 185 | Phosphorylation | CEEVRLRSFTTTIHK CCEEEEEEEEEEEHH | 31.38 | 22067460 | |
| 187 | Phosphorylation | EVRLRSFTTTIHKVN EEEEEEEEEEEHHHH | 25.03 | 25266776 | |
| 195 | Phosphorylation | TTIHKVNSMVAYKTP EEEHHHHCEEEECCC | 20.02 | 21082442 | |
| 199 | Phosphorylation | KVNSMVAYKTPVND- HHHCEEEECCCCCC- | 12.18 | 29514104 | |
| 201 | Phosphorylation | NSMVAYKTPVND--- HCEEEECCCCCC--- | 21.57 | 26643407 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MD2L1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MD2L1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MD2L1_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
