UniProt ID | RPP14_HUMAN | |
---|---|---|
UniProt AC | O95059 | |
Protein Name | Ribonuclease P protein subunit p14 | |
Gene Name | RPP14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 124 | |
Subcellular Localization | Nucleus . | |
Protein Description | Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.. | |
Protein Sequence | MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MPAPAATYERVVYKN CCCCCCEEEEEEECC | 9.30 | 27642862 | |
17 | Phosphorylation | RVVYKNPSEYHYMKV EEEECCHHHCCEEEE | 61.25 | - | |
19 | Phosphorylation | VYKNPSEYHYMKVCL EECCHHHCCEEEEEH | 11.55 | - | |
79 | Phosphorylation | SAILRICSSGLVKLW HHHHHHHHHCHHHHH | 25.68 | 29083192 | |
80 | Phosphorylation | AILRICSSGLVKLWS HHHHHHHHCHHHHHH | 31.56 | 29083192 | |
87 | Phosphorylation | SGLVKLWSSLTLLGS HCHHHHHHHCHHHCC | 26.38 | 29083192 | |
88 | Phosphorylation | GLVKLWSSLTLLGSY CHHHHHHHCHHHCCC | 17.50 | 29083192 | |
90 | Phosphorylation | VKLWSSLTLLGSYKG HHHHHHCHHHCCCCC | 23.14 | 29083192 | |
94 | Phosphorylation | SSLTLLGSYKGKKCA HHCHHHCCCCCCCCE | 24.52 | 29083192 | |
95 | Phosphorylation | SLTLLGSYKGKKCAF HCHHHCCCCCCCCEE | 23.20 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPP14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPP14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPP14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPP30_HUMAN | RPP30 | physical | 15096576 | |
RPP40_HUMAN | RPP40 | physical | 15096576 | |
IGS21_HUMAN | IGSF21 | physical | 16169070 | |
DOCK7_HUMAN | DOCK7 | physical | 21900206 | |
A2MG_HUMAN | A2M | physical | 21900206 | |
MSH2_HUMAN | MSH2 | physical | 21900206 | |
WIZ_HUMAN | WIZ | physical | 21900206 | |
KMT2B_HUMAN | KMT2B | physical | 21900206 | |
PSME1_HUMAN | PSME1 | physical | 21900206 | |
ATPB_HUMAN | ATP5B | physical | 21900206 | |
CAPZB_HUMAN | CAPZB | physical | 21900206 | |
KPYM_HUMAN | PKM | physical | 21900206 | |
NOVA1_HUMAN | NOVA1 | physical | 21900206 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...