| UniProt ID | SF3A2_HUMAN | |
|---|---|---|
| UniProt AC | Q15428 | |
| Protein Name | Splicing factor 3A subunit 2 | |
| Gene Name | SF3A2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 464 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.. | |
| Protein Sequence | MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDFQHRPG -------CCCCCCCC | 11.98 | - | |
| 10 | Ubiquitination | FQHRPGGKTGSGGVA CCCCCCCCCCCCCCC | 56.48 | - | |
| 10 | Malonylation | FQHRPGGKTGSGGVA CCCCCCCCCCCCCCC | 56.48 | 26320211 | |
| 11 | Phosphorylation | QHRPGGKTGSGGVAS CCCCCCCCCCCCCCC | 39.59 | 27794612 | |
| 13 | Phosphorylation | RPGGKTGSGGVASSS CCCCCCCCCCCCCCC | 37.29 | 25159151 | |
| 18 | Phosphorylation | TGSGGVASSSESNRD CCCCCCCCCCCCHHH | 31.80 | 29396449 | |
| 19 | Phosphorylation | GSGGVASSSESNRDR CCCCCCCCCCCHHHH | 28.52 | 27794612 | |
| 20 | Phosphorylation | SGGVASSSESNRDRR CCCCCCCCCCHHHHH | 42.42 | 27794612 | |
| 37 | Phosphorylation | LRQLALETIDINKDP HHHHHHHHCCCCCCC | 25.46 | 28555341 | |
| 42 | Acetylation | LETIDINKDPYFMKN HHHCCCCCCCHHHHH | 61.49 | 26051181 | |
| 42 | Ubiquitination | LETIDINKDPYFMKN HHHCCCCCCCHHHHH | 61.49 | 21890473 | |
| 48 | Ubiquitination | NKDPYFMKNHLGSYE CCCCHHHHHCCCCEE | 31.17 | 21890473 | |
| 54 | Nitration | MKNHLGSYECKLCLT HHHCCCCEEEEEEEE | 24.45 | - | |
| 57 | Acetylation | HLGSYECKLCLTLHN CCCCEEEEEEEEECC | 30.23 | 26051181 | |
| 61 | Phosphorylation | YECKLCLTLHNNEGS EEEEEEEEECCCCCC | 25.60 | 28152594 | |
| 68 | Phosphorylation | TLHNNEGSYLAHTQG EECCCCCCEEEECCC | 15.70 | 28152594 | |
| 69 | Phosphorylation | LHNNEGSYLAHTQGK ECCCCCCEEEECCCH | 20.82 | 28152594 | |
| 73 | Phosphorylation | EGSYLAHTQGKKHQT CCCEEEECCCHHHHH | 33.15 | 28152594 | |
| 76 | 2-Hydroxyisobutyrylation | YLAHTQGKKHQTNLA EEEECCCHHHHHHHH | 36.95 | - | |
| 76 | Acetylation | YLAHTQGKKHQTNLA EEEECCCHHHHHHHH | 36.95 | 25953088 | |
| 77 | Ubiquitination | LAHTQGKKHQTNLAR EEECCCHHHHHHHHH | 48.01 | - | |
| 77 | Acetylation | LAHTQGKKHQTNLAR EEECCCHHHHHHHHH | 48.01 | 11922691 | |
| 88 | Acetylation | NLARRAAKEAKEAPA HHHHHHHHHHHHCCC | 58.16 | 18527857 | |
| 91 | Acetylation | RRAAKEAKEAPAQPA HHHHHHHHHCCCCCC | 56.34 | 26051181 | |
| 91 | Ubiquitination | RRAAKEAKEAPAQPA HHHHHHHHHCCCCCC | 56.34 | - | |
| 101 | Acetylation | PAQPAPEKVKVEVKK CCCCCCCCEEEEEEE | 46.42 | 23749302 | |
| 101 | Ubiquitination | PAQPAPEKVKVEVKK CCCCCCCCEEEEEEE | 46.42 | - | |
| 103 | Ubiquitination | QPAPEKVKVEVKKFV CCCCCCEEEEEEEEE | 43.69 | - | |
| 103 | Sumoylation | QPAPEKVKVEVKKFV CCCCCCEEEEEEEEE | 43.69 | - | |
| 103 | Sumoylation | QPAPEKVKVEVKKFV CCCCCCEEEEEEEEE | 43.69 | - | |
| 111 | Ubiquitination | VEVKKFVKIGRPGYK EEEEEEEEECCCCCE | 42.44 | - | |
| 118 | Ubiquitination | KIGRPGYKVTKQRDS EECCCCCEEEEHHCC | 49.71 | - | |
| 150 | Methylation | EGIMPRHRFMSAYEQ CCCCCHHHHHHHHHH | 30.18 | 115916581 | |
| 153 | Phosphorylation | MPRHRFMSAYEQRIE CCHHHHHHHHHHHCC | 25.61 | 25850435 | |
| 155 | Phosphorylation | RHRFMSAYEQRIEPP HHHHHHHHHHHCCCC | 12.80 | 23186163 | |
| 155 | Nitration | RHRFMSAYEQRIEPP HHHHHHHHHHHCCCC | 12.80 | - | |
| 176 | Phosphorylation | LLMAAEPYETIAFKV HHHHCCCCCEEEEEC | 19.74 | - | |
| 194 | Ubiquitination | EIDKAEGKFWTHWNR HHHHHCCCEECCCCH | 29.27 | 21890473 | |
| 194 | Acetylation | EIDKAEGKFWTHWNR HHHHHCCCEECCCCH | 29.27 | 27452117 | |
| 197 | Phosphorylation | KAEGKFWTHWNRETK HHCCCEECCCCHHHH | 21.83 | 29523821 | |
| 216 | Ubiquitination | QFHFKMEKPPAPPSL EEEEECCCCCCCCCC | 53.45 | - | |
| 216 | Acetylation | QFHFKMEKPPAPPSL EEEEECCCCCCCCCC | 53.45 | 26051181 | |
| 222 | Phosphorylation | EKPPAPPSLPAGPPG CCCCCCCCCCCCCCC | 46.02 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SF3A2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SF3A2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SF3A2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |