UniProt ID | SF3B6_HUMAN | |
---|---|---|
UniProt AC | Q9Y3B4 | |
Protein Name | Splicing factor 3B subunit 6 | |
Gene Name | SF3B6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. [PubMed: 27720643 SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA] | |
Protein Sequence | MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MAMQAAKRANIRLP -CCHHHHHHCCCCCC | 33845483 | ||
7 | 2-Hydroxyisobutyrylation | -MAMQAAKRANIRLP -CCHHHHHHCCCCCC | - | ||
7 | Acetylation | -MAMQAAKRANIRLP -CCHHHHHHCCCCCC | 25953088 | ||
7 | Sumoylation | -MAMQAAKRANIRLP -CCHHHHHHCCCCCC | - | ||
7 | Sumoylation | -MAMQAAKRANIRLP -CCHHHHHHCCCCCC | - | ||
28 | Phosphorylation | LYIRNLPYKITAEEM EEECCCCCEEEHHHH | 29496907 | ||
29 | Ubiquitination | YIRNLPYKITAEEMY EECCCCCEEEHHHHH | 21890473 | ||
29 | Acetylation | YIRNLPYKITAEEMY EECCCCCEEEHHHHH | 19608861 | ||
29 | Sumoylation | YIRNLPYKITAEEMY EECCCCCEEEHHHHH | 28112733 | ||
29 | Ubiquitination | YIRNLPYKITAEEMY EECCCCCEEEHHHHH | 23000965 | ||
36 | Phosphorylation | KITAEEMYDIFGKYG EEEHHHHHHHHHCCC | 27642862 | ||
41 | Ubiquitination | EMYDIFGKYGPIRQI HHHHHHHCCCCEEEE | 23000965 | ||
41 | Ubiquitination | EMYDIFGKYGPIRQI HHHHHHHCCCCEEEE | 21890473 | ||
41 | Acetylation | EMYDIFGKYGPIRQI HHHHHHHCCCCEEEE | 19608861 | ||
59 | Phosphorylation | NTPETRGTAYVVYED CCCCCCCEEEEEEEC | 29496907 | ||
61 | Phosphorylation | PETRGTAYVVYEDIF CCCCCEEEEEEECCC | 23822953 | ||
64 | Phosphorylation | RGTAYVVYEDIFDAK CCEEEEEEECCCCHH | 27642862 | ||
71 | Acetylation | YEDIFDAKNACDHLS EECCCCHHHHHHHCC | 26051181 | ||
71 | Ubiquitination | YEDIFDAKNACDHLS EECCCCHHHHHHHCC | 21906983 | ||
74 | S-nitrosocysteine | IFDAKNACDHLSGFN CCCHHHHHHHCCCCC | - | ||
83 | S-nitrosocysteine | HLSGFNVCNRYLVVL HCCCCCCCCCEEEEE | - | ||
86 | Phosphorylation | GFNVCNRYLVVLYYN CCCCCCCEEEEEEEC | 19060867 | ||
100 | Ubiquitination | NANRAFQKMDTKKKE CCHHHHHHCCCHHHH | 23000965 | ||
100 | Acetylation | NANRAFQKMDTKKKE CCHHHHHHCCCHHHH | 25953088 | ||
100 | Ubiquitination | NANRAFQKMDTKKKE CCHHHHHHCCCHHHH | - | ||
104 | Ubiquitination | AFQKMDTKKKEEQLK HHHHCCCHHHHHHHH | 23000965 | ||
105 | Ubiquitination | FQKMDTKKKEEQLKL HHHCCCHHHHHHHHH | 23000965 | ||
106 | Ubiquitination | QKMDTKKKEEQLKLL HHCCCHHHHHHHHHH | 23000965 | ||
111 | Ubiquitination | KKKEEQLKLLKEKYG HHHHHHHHHHHHHHC | 22817900 | ||
114 | Ubiquitination | EEQLKLLKEKYGINT HHHHHHHHHHHCCCC | 22817900 | ||
114 | Acetylation | EEQLKLLKEKYGINT HHHHHHHHHHHCCCC | 26051181 | ||
116 | Ubiquitination | QLKLLKEKYGINTDP HHHHHHHHHCCCCCC | 21906983 | ||
116 | Acetylation | QLKLLKEKYGINTDP HHHHHHHHHCCCCCC | 26051181 | ||
121 | Phosphorylation | KEKYGINTDPPK--- HHHHCCCCCCCC--- | 28555341 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SF3B6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SF3B6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SF3B6_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...