UniProt ID | 5HT2C_HUMAN | |
---|---|---|
UniProt AC | P28335 | |
Protein Name | 5-hydroxytryptamine receptor 2C | |
Gene Name | HTR2C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 458 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis.. | |
Protein Sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | N-linked_Glycosylation | AIVTDIFNTSDGGRF HHHEECCCCCCCCCE | 38.72 | 11150294 | |
90 | Phosphorylation | KLHNATNYFLMSLAI HHCHHHHHHHHHHHH | 8.17 | 25332170 | |
94 | Phosphorylation | ATNYFLMSLAIADML HHHHHHHHHHHHHHH | 19.45 | 25332170 | |
163 | Phosphorylation | IRNPIEHSRFNSRTK CCCCCCCCCCCHHHH | 26.27 | 28842319 | |
271 | Phosphorylation | LKCCKRNTAEEENSA HHHHHCCCHHHHHCC | 39.21 | 27251275 | |
277 | Phosphorylation | NTAEEENSANPNQDQ CCHHHHHCCCCCHHH | 32.47 | 27251275 | |
391 | Acetylation | RCNYKVEKKPPVRQI CCCCCCCCCCCCCCC | 73.83 | 7482717 | |
456 | Phosphorylation | SVVSERISSV----- HHHHHHHCCC----- | 31.13 | 10816555 | |
457 | Phosphorylation | VVSERISSV------ HHHHHHCCC------ | 29.49 | 10816555 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 5HT2C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 5HT2C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 5HT2C_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D00270 | Chlorpromazine (USP/INN); Thorazine (TN) | |||||
D00283 | Clozapine (JAN/USP/INN); Clozaril (TN) | |||||
D00403 | Levomepromazine (USAN/INN); Methotrimeprazine (USP); Levoprome (TN) | |||||
D00454 | Olanzapine (JAN/USAN/INN); Zyprexa (TN) | |||||
D00563 | Mirtazapine (JAN/USAN/INN); Remeron (TN); Reflex (TN) | |||||
D00681 | Methysergide maleate (USP); Sansert (TN) | |||||
D00789 | Chlorpromazine hydrochloride (JP16/USP); Sonazine (TN) | |||||
D00819 | Nefazodone hydrochloride (USAN); Serzone (TN) | |||||
D00820 | Trazodone hydrochloride (JAN/USP); Desyrel (TN) | |||||
D01358 | Mianserin hydrochloride (JAN/USAN); Tetramide (TN) | |||||
D01477 | Opipramol hydrochloride (JAN/USAN); Insidon (TN) | |||||
D01520 | Levomepromazine hydrochloride (JAN/USAN); Nozinan (TN) | |||||
D01902 | Dimetotiazine mesilate (JAN); Fonazine mesylate (USAN); Banistyl (TN) | |||||
D01939 | Ziprasidone hydrochloride hydrate (JAN); Ziprasidone hydrochloride (USAN); Geodon (TN) | |||||
D02034 | Setiptiline maleate (JAN); Tecipul (TN) | |||||
D02100 | Ziprasidone mesylate (USAN); Ziprasidone mesylate hydrate; Geodon (TN) | |||||
D02248 | Levomepromazine maleate (JP16/USAN); Hirnamin (TN) | |||||
D02357 | Methysergide (USAN/INN) | |||||
D02577 | Flibanserin (USAN/INN); Ectris (TN) | |||||
D02578 | Agomelatine (INN); Valdoxan (TN) | |||||
D02767 | Adatanserin hydrochloride (USAN) | |||||
D02893 | Amesergide (USAN/INN) | |||||
D02995 | Asenapine maleate (USAN); Saphris (TN) | |||||
D03274 | Chlorpromazine hibenzate (JAN); Contomin (TN) | |||||
D03506 | Cinanserin hydrochloride (USAN) | |||||
D04034 | Chlorpromazine phenolphthalinate (JAN); Wintermin (TN) | |||||
D04320 | Glemanserin (USAN/INN); MDL 11939 | |||||
D04820 | Lurasidone hydrochloride (JAN/USAN); SM 13496; Latuda (TN) | |||||
D05015 | Metrenperone (USAN/INN) | |||||
D05395 | Pelanserin hydrochloride (USAN) | |||||
D05523 | Pizotyline (USAN); Pizotifen (INN); Sandomigran (TN) | |||||
D05738 | Ritanserin (USAN/INN); Tiserton (TN) | |||||
D06253 | Tropanserin hydrochloride (USAN) | |||||
D06613 | Lorcaserin hydrochloride (USAN); APD-356; Belviq (TN) | |||||
D06623 | Olanzapine pamoate (USAN); Olanzapine pamoate monohydrate | |||||
D07218 | Metergoline (INN) | |||||
D07854 | Dimetotiazine (INN); Fonazine; Migristene (TN) | |||||
D08216 | Mianserin (INN); Tolvon (TN) | |||||
D08257 | Nefazodone (INN) | |||||
D08297 | Opipramol (INN); Opipramol dura (TN) | |||||
D08397 | Pizotifen malate; Mosegor (TN); Sandomigran (TN) | |||||
D08511 | Setiptiline (INN) | |||||
D08687 | Ziprasidone (INN); Zipradon (TN) | |||||
D09819 | Chlorpromazine tannate (JAN) | |||||
D10170 | Tedatioxetine (USAN) | |||||
D10171 | Tedatioxetine hydrobromide (USAN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...