UniProt ID | ATP8_HUMAN | |
---|---|---|
UniProt AC | P03928 | |
Protein Name | ATP synthase protein 8 | |
Gene Name | MT-ATP8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 68 | |
Subcellular Localization |
Mitochondrion membrane Single-pass membrane protein. |
|
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).. | |
Protein Sequence | MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | TQLKMLNTNYHLPPS HHHHHHCCCCCCCCC | 32.94 | 28122231 | |
33 | Phosphorylation | LKMLNTNYHLPPSPK HHHHCCCCCCCCCCC | 11.60 | 28122231 | |
38 | Phosphorylation | TNYHLPPSPKPMKMK CCCCCCCCCCCCCCC | 43.55 | 25159151 | |
40 | Ubiquitination | YHLPPSPKPMKMKNY CCCCCCCCCCCCCCC | 63.18 | 21890473 | |
40 | Acetylation | YHLPPSPKPMKMKNY CCCCCCCCCCCCCCC | 63.18 | 26210075 | |
47 | Phosphorylation | KPMKMKNYNKPWEPK CCCCCCCCCCCCCCC | 21.03 | 28152594 | |
49 | Acetylation | MKMKNYNKPWEPKWT CCCCCCCCCCCCCCC | 40.94 | 23236377 | |
49 | Malonylation | MKMKNYNKPWEPKWT CCCCCCCCCCCCCCC | 40.94 | 26320211 | |
54 | Acetylation | YNKPWEPKWTKICSL CCCCCCCCCCEECCC | 56.85 | 23236377 | |
54 | Succinylation | YNKPWEPKWTKICSL CCCCCCCCCCEECCC | 56.85 | - | |
54 | Ubiquitination | YNKPWEPKWTKICSL CCCCCCCCCCEECCC | 56.85 | 21890473 | |
54 | Succinylation | YNKPWEPKWTKICSL CCCCCCCCCCEECCC | 56.85 | 21890473 | |
57 | Acetylation | PWEPKWTKICSLHSL CCCCCCCEECCCCCC | 40.37 | - | |
57 | Ubiquitination | PWEPKWTKICSLHSL CCCCCCCEECCCCCC | 40.37 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATP8_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
516070 | Mitochondrial complex V deficiency, mitochondrial 2 (MC5DM2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-49, AND MASS SPECTROMETRY. |